JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Transmembrane Protein

Recombinant Mouse CD9 antigen (Cd9)-VLPs

SKU : BHP10513706

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

CUSABIO TECHONOLOGY LLC

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	CSB-MP004969MO
Alternative Names	CD antigen CD9
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C.<br />Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Tag	C-terminal 10xHis-tagged
Molecular Weight	26.6 kDa
Relevance	Integral membrane protein associated with integrins, which regulates different processes, such as sperm-egg fusion, platelet activation and aggregation, and cell adhesion. Present at the cell surface of oocytes and plays a key role in sperm-egg fusion, possibly by organizing multiprotein complexes and the morphology of the membrane required for the fusion. In myoblasts, associates with CD81 and PTGFRN and inhibits myotube fusion during muscle regeneration. In macrophages, associates with CD9 and beta-1 and beta-2 integrins, and prevents macrophage fusion into multinucleated giant cells specialized in ingesting complement-opsonized large particles. Also prevents the fusion between mononuclear cell progenitors into osteoclasts in charge of bone resorption. Acts as a receptor for PSG17. Involved in platelet activation and aggregation. Regulates paranodal junction formation. Involved in cell adhesion, cell motility and tumor metastasis. Also regulates integrin-dependent migration of macrophages, particularly relevant for inflammatory response in the lung.
Source	Mammalian cell
Form	Lyophilized powder
Notes	The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity.<br />The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
Expression Region	1-226aa
Lead Time	3-7 business days
Organism	Mus musculus (Mouse)
Protein Length	Full Length

Uniprot	P40240
Gene Name	Cd9
Research Area	Immunology
Sequence	MPVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQENNHSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLEQFISDTCPKKQLLESFQVKPCPEAISEVFNNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV

Buffer	Lyophilized from a 0.2 um sterile filtered PBS, 6% Trehalose, pH 7.4.
Purity	The purity information is not available for VLPs proteins.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. <br />Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product Manual	<a href="https://www.cusabio.com/msds/2932058/" target="_blank">MSDS</a>

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHP10513706	CSB-MP004969MO	20ug	$570		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.