JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Recombinant Protein

Recombinant Macaca mulatta Solute carrier family 10 member 1 (SLC10A1)-VLPs

SKU : BHP10513892

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

CUSABIO TECHONOLOGY LLC

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	CSB-MP6049MOWd7
Alternative Names	Solute carrier family 10 member a1
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C.<br />Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Tag	C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
Molecular Weight	39.5 kDa
Source	Mammalian cell
Form	Lyophilized powder
Notes	The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity.<br />The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
Expression Region	1-349aa
Lead Time	3-7 business days
Protein Length	Full Length

Uniprot	F6YRK3
Gene Name	SLC10A1
Research Area	Others
Sequence	MEAHNASAPFNFTLPPNFGKRPTDLALSIILVFMLFFVMLSLGCTMEFSKIKAHLWKPKGLAIALVAQYGIMPLTAFVLGKVFQLNNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYLYTRGIYDGDLKDKVPYGRIILSLVPVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLLIAMFRCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA

Buffer	Lyophilized from a 0.2 um sterile filtered PBS, 6% Trehalose, pH 7.4.
Purity	The purity information is not available for VLPs proteins.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. <br />Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product Manual	<a href="https://www.cusabio.com/msds/12937223/" target="_blank">MSDS</a>

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHP10513892	CSB-MP6049MOWd7	20ug	$630		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.