JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.
Loding Loading ....
Home / Proteins & Peptide / Recombinant Protein

Recombinant Human Claudin-6(CLDN6)-Detergent (Active)

BHP10513923
Contact us to order
Tel
+1 866.986.9598
Email
orders@biohippo.com
Get a Quote
Request More Infos
Order Now

Credit card payments now incur a 3% fee.

Contact us to order
Tel
+1 866.986.9598
Email
orders@biohippo.com
Get a Quote
Ask Merchant
Request More Infos
Sample Request
Uniprot P56747
Gene Name CLDN6
Research Area Cancer
Sequence ASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV
Buffer 50 mM HEPES, 0.15 M NaCl, 0.05% DDM, 0.01% CHS, pH7.5
Purity Greater than 90% as determined by SDS-PAGE.
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. <br />Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Reference "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."<br />Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Gray A.M.<br />Genome Res. 13:2265-2270 (2003)<br />"Complete sequencing and characterization of 21,243 full-length human cDNAs."<br />Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Sugano S.<br />Nat. Genet. 36:40-45 (2004)
Product Manual <a href="https://www.cusabio.com/index.php?m=topdf&c=msds&a=msdsLiquid&id=12937419" target="_blank">MSDS</a>
SKU Supplier No. Size Your price Quantity
BHP10513923 CSB-MP005508HU(A5)-D 20ug $855
Add to Cart