JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Recombinant Protein

Recombinant Bombyx mori nuclear polyhedrosis virus Polyhedrin (PH)

SKU : BHP10513812

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

CUSABIO TECHONOLOGY LLC

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	CSB-EP355989BTU
Alternative Names	Major occlusion protein
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Tag	C-terminal 6xHis-tagged
Molecular Weight	35.6 kDa
Relevance	Major component of the virus occlusion bodies, which are large proteinaceous structures polyhedra, that protect the virus from the outside environment for extended periods until they are ingested by insect larvae.
Source	E.coli
Form	Liquid or Lyophilized powder
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Expression Region	2-245aa
Lead Time	13-23 business days
Organism	Bombyx mori nuclear polyhedrosis virus (BmNPV)
Protein Length	Full Length of Mature Protein

Uniprot	P03237
Gene Name	PH
Research Area	Others
Sequence	PNYSYNPTIGRTYVYDNKYYKNLGGLIKNAKRKKHLIEHEKEEKQWDLLDNYMVAEDPFLGPGKNQKLTLFKEVRNVKPDTMKLIVNWSGKEFLRETWTRFVEDSFPIVNDQEVMDVYLVANLKPTRPNRCYKFLAQHALRWDEDYVPHEVIRIMEPSYVGMNNEYRISLAKKGGGCPIMNIHSEYTNSFESFVNRVIWENFYKPIVYIGTDSAEEEEILIEVSLVFKIKEFAPDAPLFTGPAY

Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.<br />If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity	Greater than 95% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. <br />Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product Manual	<a href="https://www.cusabio.com/msds/12937149/" target="_blank">MSDS</a>

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHP10513812	CSB-EP355989BTU	20ug	$388		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.