JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide

TGF-beta 2, Mouse

SKU : BHP18500526

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

iXCells Biotechnologies

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	IX03432, IX03432-1, IX03432-10, IX03432-50
Description	Transforming growth factor beta 2 (TGF-beta2) is a member of TGF-beta superfamily that shares a characteristic cysteine knot structure. Mice with TGF-beta2 gene deletion show defects in development of cardiac, lung, craniofacial, limb, spinal column, eye, inner ear and urogenital systems. All TGF-beta isoforms signal via the same heteromeric receptor complex, consisting of a ligand binding TGF-beta receptor type II (TbetaR-II), and a TGF-beta receptor type I (TbetaR-I). Signal transduction from the receptor to the nucleus is mediated via SMADs. TGF-beta expression is found in cartilage, bone, teeth, muscle, heart, blood vessels, hematopoietic cells, lung, kidney, gut, liver, eye, ear, skin, and the nervous system. Recombinant Mouse TGF-beta2 produced by a mammalian expression system is a polypeptide chain containing 112 amino acids. A fully biologically active molecule; rm TGF-beta2 a molecular mass of 12.7 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
Reconstitution	Reconstituted in ddH?O or PBS at 100 ug/ml.
Formulation	Lyophilized from a 0.2 um filtered solution in 4 mM HCl.
Molecular Weight	12.7 kDa; observed by reducing SDS-PAGE.
Source	Human Cells
Endotoxin Level	1 EU/ug; determined by LAL method.
Bioactivity	ED50 0.2 ng/ml, measured in a cell proliferation assay using mouse HT-2 cells.

Synonyms	TGFB2; BSC-1 cell growth inhibitor; Cetermin; Glioblastoma-derived T-cell suppressor factor; G-TSF; MGC116892; Polyergin; TGF-beta2; TGF-beta-2; transforming growth factor beta-2
Sequence	Ala³?³-Ser?¹? (Accession #: P27090); ?ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIH?EPKGYNANFCAGACPYLWSSDTQHTKVLSLY NT?INPEASASPCCVSQDLEPLTILYYIGNTPKIEQL?SNMIVKSCKCS

Purity	95% as analyzed by SDS-PAGE.
Storage	Lyophilized recombinant TGF-beta2, Mouse remains stable up to 6 months at lower than -70°C from date of receipt. Upon reconstitution; Mouse TGF-beta2 should be stable up to 1 week at 4°C or up to 3 months at -20°C. For long term storage it is recommended that a carrier protein (example 0.1% BSA) be added. Avoid repeated freeze-thaw cycles.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP18500526-1	IX03432-1	1mg	$3744		Add to Cart
BHP18500526-2	IX03432-10	10ug	$245		Add to Cart
BHP18500526-3	IX03432-50	50ug	$687		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2024 Biohippo. All rights reserved.