JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide

ShK (Stichodactyla Toxin)

SKU : BHP21300280

A Blocker of KV Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STS-400, STS-400_0.1 mg, STS-400_0.25 mg, STS-400_0.5 mg, STS-400_1 mg, STS-400_10 mg, STS-400_5 mg
Description	A Blocker of KV Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C169H274N54O48S7
Background	ShK (Stichodactyla Toxin) is a peptidyl toxin originally isolated from the nematocyst of the sea anemone Stichodactyla helianthus.1ShK blocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar concentrations and KV3.2 channels at 1000-fold higher concentration than that required to inhibit KV1.3 channels. It has been shown to block KV current in DRG neurons, to displace radioactive Dendrotoxin from brain synaptosomes1 and inhibit I125-Charybdotoxin binding to Jurkat T lymphocytes with an IC50 of 32 pM2,4Evidence also suggests that native KV currents in the central nervous system, which are predominantly carried by KV1.2 channels, are highly sensitive to this toxin.5A fluorescently labeled synthetic ShK is used to recognize and to sort KV1.3 containing lymphocytes.4,6
Biological Activity	Stichodactyla Toxin blocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar concentrations and KV3.2 channels at 1000-fold higher concentration than that required to inhibit KV1.3 channels.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	4054.8 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P29187
Concentration	1 - 100 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
Cas Number	172450-46-3
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys3-Cys35, Cys12-Cys28, and Cys17-Cys32
Origin	Stichodactyla helianthus (Sun anemone) (Stoichactis helianthus)

Synonyms	Kappa-stichotoxin-She3a, Potassium channel toxin ShK, Kappa-SHTX-She3a
Gene Id	KCNA1 ,KCNA2 ,KCNA3,KCNA4,KCNA6,KCNA7,KCNN4
Sequence	RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC-OH
Target	Various KV K+ channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Castaneda, O. et al. (1995) Toxicon 33, 603. Pennington, M. W. et al. (1995) Int. J. Pept. Protein Res. 46, 354. Beeton, C. et al. (2003) J. Biol. Chem. 278, 9928. Middleton, R.E. et al. (2003) Biochemistry 42, 13698. Yan, L. et al. (2005) Mol. Pharmacol. 67, 1513.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300280-1	STS-400_0.1 mg	0.1 mg	$130		Add to Cart
BHP21300280-2	STS-400_0.25 mg	0.25 mg	$273		Add to Cart
BHP21300280-3	STS-400_0.5 mg	0.5 mg	$436		Add to Cart
BHP21300280-4	STS-400_1 mg	1 mg	$698		Add to Cart
BHP21300280-5	STS-400_10 mg	10 mg	$4459		Add to Cart
BHP21300280-6	STS-400_5 mg	5 mg	$2787		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.