JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide

Scyllatoxin

SKU : BHP21300277

A Potent Blocker of KCa2 (SK) K+ Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STS-370, STS-370_0.1 mg, STS-370_0.25 mg, STS-370_0.5 mg, STS-370_1 mg, STS-370_10 mg, STS-370_5 mg
Description	A Potent Blocker of KCa2 (SK) K+ Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C142H237N45O39S7
Background	Scyllatoxin is a 31 amino acid long toxin, originally isolated from the Leiurus quinquestriatus hebraeus scorpion venom, and is classified as alpha-KTx 5.1 scorpion toxin family, having three disulfide bridges1,2.Scyllatoxin was shown to compete with 125I-apamin binding in the brain3. Furthermore, Scyllatoxin appears to be selective for apamin-sensitive SK channels. Scyllatoxin inhibits apamin-sensitive SK channel activity in guinea-pig and rabbit hepatocytes4, SK currents in human lymphoblastoma cells5,6, and epinephrine-induced relaxation of visceral smooth muscle7.Scyllatoxin also inhibits the apamin-sensitive after hyperpolarization that follows action potentials in skeletal muscle7 and neurons8. The SK channel-mediated after hyperpolarising current (IAHP) of dorsal vagal neurons, presuming Kca2.3 (SK3), were blocked by Scyllatoxin (20-30 nM)9. HEK 293 cell currents stably expressing hKca2.1 (hSK1) and Kca2.2 (hSK2) were blocked by Scyllatoxin with an IC50 of 80 nM and 287 pM, respectively10.
Biological Activity	Scyllatoxin inhibits small conductance Ca2+-activated K+ channels (SK)1-3.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	3423 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P16341
Concentration	20 - 200 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
Cas Number	142948-19-4
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys3-Cys21, Cys8-Cys26, and Cys12-Cys28 His31 - C terminal amidation
Origin	Leiurus hebraeus (Hebrew deathstalker scorpion) (Leiurus quinquestriatus hebraeus)

Synonyms	K+ channel toxin alpha-KTx 5.1, Leiurotoxin I, LeTx I, ScyTx
Gene Id	KCNN1,KCNN2,KCNN3
Sequence	AFCNLRMCQLSCRSLGLLGKCIGDKCECVKH-NH2
Target	KCa2 K+ channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Chicchi, G.G. et al. (1988) J. Biol. Chem. 263, 10192. Rodriguez de la Vega, R.C. and Possani, L.D. (2004) Toxicon 43, 865. Auguste, P. et al. (1992) Biochemistry 31, 648. Wadsworth, J.D. et al. (1994) J. Biol. Chem. 269, 18053. Grissmer, S. et al. (1992) J. Gen. Physiol. 99, 63. Jager, H. and Grissmer, S. (1997) Cell. Physiol. Biochem. 7, 179. Auguste, P. et al. (1990) J. Biol. Chem., 265, 4753. Goh, J.W. et al. (1992) Brain Res. 591. 165. Pedarzani, P. et al. (2000) J. Physiol. 527, 283. Strøbaek, D. et al. (2000) Br. J. Pharmacol. 129, 991. Wadsworth, J.D. et al. (1994) J. Biol. Chem. 269, 18053. Grissmer, S. et al. (1992) J. Gen. Physiol. 99, 63. Jager, H. and Grissmer, S. (1997) Cell. Physiol. Biochem. 7, 179.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300277-1	STS-370_0.1 mg	0.1 mg	$130		Add to Cart
BHP21300277-2	STS-370_0.25 mg	0.25 mg	$273		Add to Cart
BHP21300277-3	STS-370_0.5 mg	0.5 mg	$436		Add to Cart
BHP21300277-4	STS-370_1 mg	1 mg	$659		Add to Cart
BHP21300277-5	STS-370_10 mg	10 mg	$4082		Add to Cart
BHP21300277-6	STS-370_5 mg	5 mg	$2621		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.