JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Peptide

SAP102 Blocking Peptide

SKU : BHP21301146

A Blocking Peptide for Anti-SAP102 Antibody

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	BLP-PZ003
Description	SAP102 Blocking Peptide (#BLP-PZ003) is the original antigen used for immunization during Anti-SAP102 Antibody (#APZ-003) generation. The blocking peptide binds and 'blocks' Anti-SAP102 primary antibody, this makes it a good negative reagent control to help confirm antibody specificity in western blot and immunohistochemistry applications. This control is also often called a pre-adsorption control.
Reconstitution	100 ul PBS
Formulation	Lyophilized Powder.
Accession Number	BLP
Concentration	1.2 mg/ml.
Form	Lyophilized powder
Notes	Peptide confirmation: Confirmed by DNA sequence and SDS-PAGE Is Toxin: No Standard quality control of each lot: Western blot analysis. Antibodies part of immunogen: GST fusion protein with the sequence KSTPKLNGSGPSWWPECTCTNRDWYEQVNGSD, corresponding to amino acid residues 93-124 of human SAP102 Antigen preadsorption control: 3 ug fusion protein per 1 ug antibody
UNSPSC Code	41105329
Lead Time	1-2 Business Days

Gene Id	1741
Sequence	GST fusion protein with the sequence KSTPKLNGSGPSWWPECTCTNRDWYEQVNGSD, corresponding to amino acid residues 93-124 of human SAP102
Target	DLG3

Country Of Origin	Israel/IL
Shipping	Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C
Purity	>95% (SDS-PAGE)
Storage	Storage After Reconstitution: -20°C. Storage Before Reconstitution: Lyophilized powder can be stored intact at room temperature for two weeks. For longer periods, it should be stored at -20°C

Applications	WB, IHC

Product Manual	SDS

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
			-		Add to Quote

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.