JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide

Recombinant human Pleiotrophin protein

SKU : BHP21300087

Human Pleiotrophin, Recombinant, E. coli

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	P-150, P-150_10 mcg, P-150_5 mcg
Description	Human Pleiotrophin, Recombinant, E. coli
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeated freeze-thaw cycles may result in loss of activity.
Background	Pleiotrophin (PTN), is a heparin-binding neurotrophic factor. Cells that express either PTN or PTN mRNA include osteoblasts, fetal chondrocytes,1 astrocytes, oligodendroglia, neurons,2 Schwann cells,3 keratinocytes of the stratum basale,3 and selected tumor cell lines.4,5 The expression of PTN increases during the process of brain embryogenesis and reaches maximum levels at time of birth.The role of PTN in neurogenesis and neural plasticity has been revealed by various studies. Embryonic cortical neurons adhere to and extend neurites on PTN coated substratuM6 PTN also induces, in vitro, migration of osteoblasts. 7 PTN coated membrane enhances neuronal migration by haptotaxis.8 PTN bound to agarose beads induces clustering of acetylcholine receptors on embryonic myoblasts.9PTN is expressed in the CA1 region of rat hippocampus in an activity-dependent manner, and is suggested to be involved in the regulation of synaptic plasticity in the hippocampus.10Transfection with PTN cDNA, transforms murine 3T3 fibroblasts into cells that form extensively metastasizing tumors in nude mice.11 PTN is highly expressed in choriocarcinoma, melanoma and, prostate carcinoma. Serum PTN increase in patients with pancreatic and colon carcinomas.12After focal forebrain ischemia, PTN is expressed in astrocytes, OX-42 positive macrophages, and endothelial cells in areas of developing neovascularization.13 PTN is also deposited in senile plaques in Alzheimer's disease and Down's syndrome.14
Biological Activity	Pleiotrophin is a member of the heparin-binding neurotrophic factor family. It is a developmentally regulated neurotrophic factor which promotes neurite outgrowth, axonal guidance and synaptogenesis1-4.
Formulation	Lyophilized from double distilled water (ddH2O).
Molecular Weight	15.4 kDa
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeat freeze-thawing may result in loss of activity.
Source	Recombinant, E. coli
Accession Number	P21246
Concentration	EC50 = ~0.65 - 6.5 pM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: yes Is Toxin: No
UNSPSC Code	12352202
Lead Time	1-2 Business Days

Synonyms	PTN
Gene Id	SDC3, ALK, PTPRZ1
Sequence	MGKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reference	Nakagawara, A. et al. (1995) Cancer Res. 55, 1792. Kuo, M.D. et al. (1992) Biochem. Biophys. Res. Commun. 182, 188. Raulo, E. et al. (1994) J. Biol. Chem. 269, 12999. Mitsiadis, T.A. et al. (1995) Development 121, 37. Rauvala, H. (1989) EMBO. J. 8, 2933. Imai, S. et al. (1998) J. Cell Biol. 143, 1113. Maeda, N. et al. (1998) J. Cell Biol. 142, 203. Peng, H.B. et al. (1995) J. Neurosci. 15, 3027. Lauri, S.E. et al. (1998) Eur. J. Neurosci. 10, 188. Chauhan, A.K. et al. (1993) Proc. Natl. Acad. Sci. U.S.A. 90, 679. Souttou, B. et al. (1998) J. Natl. Cancer Inst. 90, 1468. Yeh, H.J. et al. (1998) J. Neurosci. 18, 3699. Wisniewski, T. et al. (1996) Neuroreport 7, 667. Garver, R.I. et al. (1994) Cancer 74, 1584. Li, Y.S. et al. (1990) Science 250, 1690. Asai, T. et al. (1997) Biochem. Biophys. Res. Commun. 236, 60. Owada, K. et al. (1999) J. Neurochem. 73, 2084. Rauvala, H. and Peng, H.B. (1997) Prog. Neurobiol. 52, 127.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300087-1	P-150_10 mcg	10 mcg	$117		Add to Cart
BHP21300087-2	P-150_5 mcg	5 mcg	$66		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.