JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide

Recombinant human Persephin protein

SKU : BHP21300095

Human Persephin, Recombinant, E. coli

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	P-320, P-320_10 mcg, P-320_5 mcg
Description	Human Persephin, Recombinant, E. coli
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeated freeze-thaw cycles may result in loss of activity.
Background	Persephin is a novel neurotrophic factor related to GDNF and Neurturin in the GDNF subfamily.1 Persephin is ubiquitously expressed, although at very low levels.2In sharp contrast to GDNF and Neurturin, Persephin does not support the survival of neurons from peripheral ganglia including sympathetic and parasympathetic neurons, sensory neurons and enteric neurons.1,3 Persephin does promote the survival of midbrain dopaminergic neurons after neurotoxic injury and the survival of spinal motor neurons in vitro and in vivo animal models.The receptor for Persephin is a multi-component complex composed of RET tyrosine kinase and the glycosyl-phosphatidylinositol (GPI)-anchored co-receptor GFRalpha1-alpha4.4,5Persephin induces, in vitro, branching of the ureteric bud of the kidney, an activity shared by Neurturin and GDNF.1 Both in vitro and in vivo experiments using animal models suggest that Persephin could be useful in the treatment of neurodegenerative diseases including Parkinson's disease and Amyotrophic Lateral Sclerosis (ALS).6
Biological Activity	Persephin promotes the survival of mesencephalic, dopaminergic and motor neurons1,2. The receptor for Persephin is a multicomponent complex composed of RET tyrosine kinase and the glycosyl-phosphatidylinositol (GPI)-anchored co-receptor GFR alpha1-alpha43,4.
Formulation	Lyophilized in PBS.
Molecular Weight	20.6 kDa (dimer)
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeat freeze-thawing may result in loss of activity.
Source	Recombinant, E. coli
Accession Number	O60542
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: No
UNSPSC Code	12352202
Lead Time	1-2 Business Days

Synonyms	PSP
Gene Id	GFRA4
Sequence	ALSGPCQLWSLTLSVAELGLGYASEEKVIFRYCAGSCPRGARTQHGLALARLQGQGRAHGGPCCRPTRYTDVAFLDDRHRWQRLPQLSAAACGCGG
Target	GFRa4

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reference	Jaszai, J. et al. (1998) J. Neurosci. Res. 53, 494. Bilak, M.M. (1999) Mol. Cell Neurosci. 13, 326. Enokido, Y. et al. (1998) Curr. Biol. 8, 1019. Masure, S. et al. (2000) J. Biol. Chem. 275, 39427. Akerud, P. et al. (2002) Mol. Cell. Neurosci. 21, 205. Milbrandt, J. et al. (1998) Neuron 20, 245. Bilak, M.M. (1999) Mol. Cell Neurosci. 13, 326. Enokido, Y. et al. (1998) Curr. Biol. 8, 1019. Masure, S. et al. (2000) J. Biol. Chem. 275, 39427. Milbrandt, J. et al. (1998) Neuron 20, 245.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300095-1	P-320_10 mcg	10 mcg	$117		Add to Cart
BHP21300095-2	P-320_5 mcg	5 mcg	$66		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.