JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide

Recombinant Human Low-density lipoprotein receptor-related protein 2(LRP2),partial

SKU : BHP10510800

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

CUSABIO TECHONOLOGY LLC

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	CSB-MP013096HU
Alternative Names	(LRP-2)(Glycoprotein 330)(gp330)(Megalin)
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Tag	C-terminal mFc-tagged
Molecular Weight	50.8 kDa
Relevance	Multiligand endocytic receptor . Acts together with CUBN to mediate endocytosis of high-density lipoproteins . Mediates receptor-mediated uptake of polybasic drugs such as aprotinin, aminoglycosides and polymyxin B . In the kidney, mediates the tubular uptake and clearance of leptin . Also mediates transport of leptin across the blood-brain barrier through endocytosis at the choroid plexus epithelium . Endocytosis of leptin in neuronal cells is required for hypothalamic leptin signaling and leptin-mediated regulation of feeding and body weight . Mediates endocytosis and subsequent lysosomal degradation of CST3 in kidney proximal tubule cells . Mediates renal uptake of 25-hydroxyvitamin D3 in complex with the vitamin D3 transporter GC/DBP . Mediates renal uptake of metallothionein-bound heavy metals . Together with CUBN, mediates renal reabsorption of myoglobin . Mediates renal uptake and subsequent lysosomal degradation of APOM . Plays a role in kidney selenium homeostasis by mediating renal endocytosis of selenoprotein SEPP1 . Mediates renal uptake of the antiapoptotic protein BIRC5/survivin which may be important for functional integrity of the kidney . Mediates renal uptake of matrix metalloproteinase MMP2 in complex with metalloproteinase inhibitor TIMP1 . Mediates endocytosis of Sonic hedgehog protein N-product (ShhN), the active product of SHH . Also mediates ShhN transcytosis . In the embryonic neuroepithelium, mediates endocytic uptake and degradation of BMP4, is required for correct SHH localization in the ventral neural tube and plays a role in patterning of the ventral telencephalon . Required at the onset of neurulation to sequester SHH on the apical surface of neuroepithelial cells of the rostral diencephalon ventral midline and to control PTCH1-dependent uptake and intracellular trafficking of SHH . During neurulation, required in neuroepithelial cells for uptake of folate bound to the folate receptor FOLR1 which is necessary for neural tube closure . In the adult brain, negatively regulates BMP signaling in the subependymal zone which enables neurogenesis to proceed . In astrocytes, mediates endocytosis of ALB which is required for the synthesis of the neurotrophic factor oleic acid . Involved in neurite branching . During optic nerve development, required for SHH-mediated migration and proliferation of oligodendrocyte precursor cells . Mediates endocytic uptake and clearance of SHH in the retinal margin which protects retinal progenitor cells from mitogenic stimuli and keeps them quiescent . Plays a role in reproductive organ development by mediating uptake in reproductive tissues of androgen and estrogen bound to the sex hormone binding protein SHBG . Mediates endocytosis of angiotensin-2 . Also mediates endocytosis of angiotensis 1-7 . Binds to the complex composed of beta-amyloid protein 40 and CLU/APOJ and mediates its endocytosis and lysosomal degradation . Required for embryonic heart development . Required for normal hearing, possibly through interaction with estrogen in the inner ear .
Source	Mammalian cell
Endotoxin Level	Not test.
Form	Liquid or Lyophilized powder
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Bioactivity	Not Test
Expression Region	1186-1389aa
Lead Time	3-7 business days
Protein Length	Partial

Uniprot	P98164
Gene Name	LRP2
Research Area	Immunology
Sequence	NCTASQFKCASGDKCIGVTNRCDGVFDCSDNSDEAGCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGSDEHNACVPKTCPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDCPTQPFRCPSWQWQCLGHNICVNLSVVCDGIFDCPNGTDESPLCNGNSCSDFNGGCTHECVQEPFGAKCLCPLGFLLANDSKTCE

Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity	Greater than 85% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHP10510800	CSB-MP013096HU	1mg	$4660		Add to Cart
BHP10510800	CSB-MP013096HU	100ug	$1109		Add to Cart
BHP10510800	CSB-MP013096HU	20ug	$396		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2024 Biohippo. All rights reserved.