JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide

Psalmotoxin-1

SKU : BHP21300265

A Potent Blocker of ASIC1a Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STP-200, STP-200_0.1 mg, STP-200_0.25 mg, STP-200_0.5 mg, STP-200_1 mg, STP-200_10 mg, STP-200_5 mg
Description	A Potent Blocker of ASIC1a Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C200H312N62O57S6
Background	Native Psalmotoxin1 (PcTx1) is a 40-amino acid toxin originally isolated from the venom of the South American tarantula Psalmopoeus cambridgei.1PcTX1 is characterized by the unusual quadruplet Lys25-Arg26-Arg27-Arg28, which probably forms a strongly positive "patch" at the surface of the toxin molecule, constituting an area that is a strong candidate for channel binding site recognition. The molecular scaffold of PcTX1 is likely to be similar to that previously described for both cone snail and spider toxins5,6 and comprises a triple-stranded antiparallel beta-sheet structure reticulated by three disulfide bridges.1PcTx1 potently (IC50 = 0.9 nM) and specifically blocks a particular subclass of H+-gated cation channels, the Acid-sensing ion channels 1a (ASIC1a) and is able to discriminate between the two splice variant subtypes and not block the ASIC1b channel (which differs only in its N-terminal sequence). Moreover, PcTX1 loses its capacity to block ASIC1a as soon as this subunit is associated with another member of the family (ASIC2a or ASIC3).1The ASICs are abundant in the brain and spinal cord neurons and are implicated in pain sensation, ischemic stroke mechanosensation, learning and memory.2,3 In acute and neuropathic pain models, specific blockage of ASIC1a with PcTx1 results in analgesic effects working upstream of the opiate receptors.4Using an iodinated form of the toxin, the binding for the PcTX1 site identifies at the cysteine-rich domains I and II (CRDI and CRDII) of the extracellular loop of ASIC1a. A disulphide bridge between domains 1 and 4 of the channel supports a close relationship between the CRDI4-CRDII domain, where PcTx1 acts, and the post-M1 region, the binding site for the proton.7
Biological Activity	Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a)1,2.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	4689.5 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P60514
Concentration	1 - 10 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Cited Application: Electrophysiology Is Toxin: Yes
Cas Number	316808-68-1
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys3-Cys18, Cys10-Cys23 and Cys17-Cys33
Origin	Psalmopoeus cambridgei (Trinidad chevron tarantula)

Synonyms	PcTx-1, PcTx1, Ï-Theraphotoxin-Pc1a, Psalmotoxin 1
Gene Id	ASIC1,ASIC1a,ASIC1b
Sequence	EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT-OH
Target	ASIC1a channels

Country Of Origin	Israel/IL
Purity	>=99% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Escoubas, P. et al. (2000) J. Biol. Chem. 275, 25116. Sluka, S.P. et al. (2007) Pain 129, 102. Jastil, J. et al. (2007) Nature 449, 316. Mazzuca, M. et al. (2007) Nat. Neurosci. 10, 943. Narasimhan, L. et al. (1994) Nat. Struct. Biol. 1, 850. Pallaghy, P. K. et al. (1994) Protein Sci. 3, 1833. Salinas, M. et al. (2005) J. Physiol. 570, 339. Chen, X. et al. (2005) J. Gen. Physiol. 126, 71. Chen, X. et al. (2006) J. Gen. Physiol. 127, 267.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300265-1	STP-200_0.1 mg	0.1 mg	$130		Add to Cart
BHP21300265-2	STP-200_0.25 mg	0.25 mg	$273		Add to Cart
BHP21300265-3	STP-200_0.5 mg	0.5 mg	$438		Add to Cart
BHP21300265-4	STP-200_1 mg	1 mg	$701		Add to Cart
BHP21300265-5	STP-200_10 mg	10 mg	$4480		Add to Cart
BHP21300265-6	STP-200_5 mg	5 mg	$2800		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.