JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide

Margatoxin

SKU : BHP21300251

A Blocker KV1.3 and KV1.6 K+ Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STM-325, STM-325_0.1 mg, STM-325_0.25 mg, STM-325_0.5 mg, STM-325_1 mg, STM-325_10 mg, STM-325_5 mg
Description	A Blocker KV1.3 and KV1.6 K+ Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C178H286N52O50S7
Background	Margatoxin is a peptidyl toxin originally isolated from the scorpion Centruroides margaritatus. It is a specific blocker of KV1.3 channels (IC50~30 pM), but it also blocks KV1.6 and a splice variant of the Drosophila Shaker channels with IC50 of 5 and 150 nM respectively.2 In Xenopus oocytes the toxin is less potent and inhibits expressed KV1.3 channels with an apparent IC50 of ~1 nM2
Biological Activity	Margatoxin is a blocker of KV1.3 and KV1.6 channels.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	4179 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P40755
Concentration	50 pM - 50 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Cited Application: Electrophysiology Is Toxin: Yes
Cas Number	145808-47-5
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys7-Cys29, Cys13-Cys34, and Cys17-Cys36
Origin	Centruroides margaritatus (Central American bark Scorpion)

Synonyms	Potassium channel toxin alpha-KTx 2.2, MgTX-theraphotoxin-Hh2a, MgTX
Gene Id	KCNA1 ,KCNA2 ,KCNA3,KCNA6
Sequence	TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH-OH
Target	KV1.3, KV1.6 K+ channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Garcia-Calvo, M. et al. (1993) J. Biol. Chem. 268, 18866. Leonard, R.J. et al. (1992) Proc. Natl. Acad. Sci. U.S.A. 89, 10094.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300251-1	STM-325_0.1 mg	0.1 mg	$125		Add to Cart
BHP21300251-2	STM-325_0.25 mg	0.25 mg	$218		Add to Cart
BHP21300251-3	STM-325_0.5 mg	0.5 mg	$350		Add to Cart
BHP21300251-4	STM-325_1 mg	1 mg	$559		Add to Cart
BHP21300251-5	STM-325_10 mg	10 mg	$3568		Add to Cart
BHP21300251-6	STM-325_5 mg	5 mg	$2231		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.