JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide

Kaliotoxin-1

SKU : BHP21300246

A Powerful Blocker of KCa1.1 and certain KV1 Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STK-370, STK-370_0.1 mg, STK-370_0.25 mg, STK-370_0.5 mg, STK-370_1 mg, STK-370_10 mg, STK-370_5 mg
Description	A Powerful Blocker of KCa1.1 and certain KV1 Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C171H284N56O48S6
Background	Kaliotoxin-1 is a 38 amino acid long toxin, originally isolated from the venom of Androctonus mauretanicus mauretanicus scorpion and is classified as alpha-KTX 3.1 scorpion toxin family, having three disulfide bridges1,2.Kaliotoxin-1 is a potent inhibitor of large conductance Ca2+-activated K+ channels (BKCa)3, and it also binds and inhibits Dendrotoxin-sensitive voltage-dependent K+ channels, mainly KV1.1 (KCNA1), KV1.2 (KCNA2) and KV1.3 (KCNA3) with a Kd of 1.5, 25 and 0.1 nM, respectively4-6. Its binding affinity to rat brain synaptosomes is 5-fold higher than that of Kaliotoxin-37.The 3D structure of Kaliotoxin was determined by NMR spectroscopy and showed significant differences from structures established for other related scorpion toxins8,9.In vivo application of Kaliotoxin was shown to facilitate cognitive processes such as learning in rats10.
Biological Activity	Kaliotoxin-1 is a potent inhibitor of large conductance Ca2+-activated K+ channels (BKCa)1,2. Kaliotoxin-1 also binds the dendrotoxin sensitive voltage-dependent K+ channels (KV1.1, KV1.2 and KV1.3 nM)3.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	4149 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P24662
Concentration	10 - 100 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
Cas Number	145199-73-1
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between Cys8-Cys28, Cys14-Cys33, and Cys18-Cys35 Lys38 - C-terminal amidation.
Origin	Androctonus mauritanicus mauritanicus (Scorpion)

Synonyms	K+ channel toxin alpha-KTx 3.1, KTX-1
Gene Id	KCNA1 ,KCNA2 ,KCNA3,KCNMA1
Sequence	GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK-NH2
Target	KCa1.1 and some KV1 K+ channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Crest, M. et al. (1992) J. Biol. Chem. 267, 1640. Rodriguez de la Vega, R.C. and Possani, L.D. (2004) Toxicon 43, 865. Romi, R. et al. (1993) J. Biol. Chem. 268, 26302. Mourre, C. et al. (1999) J. Pharmcol. Exp. Ther. 291, 943. Grissmer, S. et. al. (1994) Mol. Pharmacol. 45, 1227. Hopkins, W.F. et al. (1996) Curr. Pharmaceut. Design. 2, 389. Tricaud, N. et al. (2000) Toxicon 38, 1749. Gairi, M. et al. (1997) J. of Peptide Sci. 3, 314. Korukottu , J. et al. (2008) PLoS ONE 3, e2359. Kourrich, S. et al. (2001) Behav. Brain Res. 120, 35. Crest, M. et al. (1992) J. Biol. Chem. 267, 1640. Romi, R. et al. (1993) J. Biol. Chem. 268, 26302. Mourre, C. et al. (1999) J. Pharmcol. Exp. Ther. 291, 943.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300246-1	STK-370_0.1 mg	0.1 mg	$130		Add to Cart
BHP21300246-2	STK-370_0.25 mg	0.25 mg	$235		Add to Cart
BHP21300246-3	STK-370_0.5 mg	0.5 mg	$376		Add to Cart
BHP21300246-4	STK-370_1 mg	1 mg	$603		Add to Cart
BHP21300246-5	STK-370_10 mg	10 mg	$3853		Add to Cart
BHP21300246-6	STK-370_5 mg	5 mg	$2408		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.