JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide

Human Recombinant Tau dGAE (297-391) AD-mimic PFFs (fibrilized without heparin)

SKU : BHP11901230

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

StressMarq Biosciences Inc.

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	SPR-502, SPR-502B, SPR-502C, SPR-502E, SPR-502XE
Alternative Names	Tau aggregate, Tau PFFs, Tau PFF, Tau protein aggregate, Tau protein, microtubule-associated protein Tau, MAPT, MAP, microtubule-associated protein, Truncated Tau Protein Aggregate, Paired Helical Filament-Tau, Phf-Tau, Neurofibrillary Tangle Protein, dGAE Tau Protein, Tau dGAE
Certificate Of Analysis	Protein certified >95% pure on SDS-PAGE & Nanodrop analysis. Low endotoxin <5 EU/mL @ 2mg/mL.
Field Of Use	Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
Scientific Background	Filamentous tau inclusions are a hallmark of many neurodegenerative diseases, including Alzheimer s disease (AD) and Chronic Traumatic Encephalopathy (CTE), collectively called tauopathies. Advances in Cryo-EM have revealed that tau filaments isolated from individuals with a particular neurodegenerative disease share a distinct tau fold i.e. an AD-isolated Tau filaments fold is distinct from a CTE-isolated Tau filaments fold (1-3). Utilizing Tau filaments with the correct disease-specific fold is an important goal towards better mimicking specific human diseases in cellular and in vivo models. Recent Cryo-EM studies have demonstrated that recombinantly generated Tau dGAE monomers will form the disease-isolated AD or CTE Tau filament folds under highly specific conditions in vitro (4, 5). StressMarq s catalog# SPR-502 Tau dGAE (297-391) AD-mimic PFFs are purified and fibrilized under these exact published conditions that replicate the disease-isolated AD-fold (200 rpm at 37oC in 10 mM PB 10 mM DTT pH 7.4 200 mM MgCl2 for 48 hours).
Species	Human
Specificity	10.165 kDa
Concentration	Lot/batch specific. See included datasheet.
Purification	Ion-exchange Purified
Expression System	E. coli
Amino Acid Sequence	IKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAE
Cite This Product	Human Recombinant Tau dGAE (297-391) AD-mimic Pre-formed Fibrils (StressMarq Biosciences Inc. \| Victoria BC CANADA \| Catalog # SPR-502B)
Nature	Recombinant
Protein Length	Fragment of full length wild-type Tau 2N4R (297 - 391aa)

Gross Weight (kg)	1.4
Launch Date	2023/11/09
Net Weight (g)	0.01
Swissprot	P10636-8
Target Details	Tau dGAE (AA297-391)
Research Area	Tangles & Tau, Alzheimer's Disease, Axon Markers, Cell Markers, Cell Signaling, Microtubules, MT Associated Proteins, Neurodegeneration, Neuron Markers, Neuroscience, Cytoskeleton

Adr Code	Non-hazardous
Country Of Origin	Canada
Tarriff Code	3822.00.1090
Un Code For Transport	Non-hazardous
Unspsc Code	12352202
Shipping Temperature	Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.
Purity	>95%
Storage Buffer	10mM PB pH 7.4, 10mM DTT, 200mM MgCl2
Storage Temperature	-80°C

Applications	In vivo assay, In vitro assay, WB

Reference	1. Goedert, Eisenberg and Crowther. 2017. Propagation of Tau Aggregates and Neurodegeneration. Annu Rev Neurosci. DOI: https://doi.org/10.1146/annurev-neuro-072116-031153 2. Fitzpatrick et al. 2017. Cryo-EM structures of tau filaments from Alzheimer s disease. Nature. DOI: 10.1038/nature23002 3. Falcon et al. 2019. Novel tau filament fold in chronic traumatic encephalopathy encloses hydrophobic molecules. Nature. DOI: https://doi.org/10.1038/s41586-019-1026-5. 4. Lovestam et al. 2022. Assembly of Recombinant Tau into Filaments Identical to those of Alzheimer s disease and Chronic Traumatic Encephalopathy. eLife. DOI: https://doi.org/10.7554/eLife.76494 5. Lovestam et al. 2023. Disease-specific Tau Filaments Assemble via Polymorphic Intermediates. bioRxiv. https://doi.org/10.1101/2023.07.24.550295

Product Manual	Datasheet

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP11901230-1	SPR-502B	100 ug	$440		Add to Cart
BHP11901230-2	SPR-502C	100 ug x2	$790		Add to Cart
BHP11901230-3	SPR-502E	100 ug x5	$1640		Add to Cart
BHP11901230-4	SPR-502XE	500 ug (@5mg/ml)	$1640		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.