JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide

Human Amyloid Beta Pyroglutamate 3-42 PFFs

SKU : BHP11901221

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

StressMarq Biosciences Inc.

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	SPR-492, SPR-492B, SPR-492C, SPR-492E
Alternative Names	pyro abeta, pyro amyloid beta, Abeta, Amyloid beta peptide, Beta amyloid peptide, amyloid beta precursor protein peptide, pyroglutamate amyloid beta, AbetaPE3, APP
Cellular Localization	Intracellular Vesicles, Cell Membrane
Certificate Of Analysis	Protein certified >95% pure by mass spec and HPLC
Field Of Use	Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
Scientific Background	Our Amyloid Beta pyroglutamate 3-42 (pyro Abeta) Pre-formed Fibrils are generated from Amyloid Beta Peptide 3-42 pre-treated with 1,1,1,3,3,3-Hexafluoro-2-propanol (HFIP) using a previously published method (1,2). Our pyro Abeta3-42 fibrils present as primarily long strands when observed under TEM and AFM, and have a unique high molecular weight signal on a Western Blot with an anti-amyloid beta antibody.<br /><br />Amyloid beta peptide (Abeta) is generated by protease cleavage of amyloid precursor protein (APP), which aggregates into oligomers, protofibrils, fibrils and ultimately plaques. The accumulation of Abeta plaques in the brain is considered a hallmark of Alzheimer s disease (AD), and most of the drugs tested for AD in the past 20 years have targeted amyloid beta accumulation (3). Pyroglutamate Abeta 3-42 is an N-terminally truncated peptide species that is modified by glutaminyl cyclase and has been reported to compromise 15-45% of total amyloid beta deposits in brains of AD patients (4,5). Pyroglutamate Abeta 3-42 exhibits higher aggregation propensity and neurotoxicity compared with full-length Abeta 1-42 (6,7) and is an active target in the next generation AD therapeutic development (8).
Species	Human
Specificity	4.3 kDa
Concentration	Lot/batch specific. See included datasheet.
Purification	N/A
Expression System	N/A
Amino Acid Sequence	pyroEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Cite This Product	Human Amyloid Beta pyroglutamate 3-42 Pre-formed Fibrils (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPR-492)
Nature	Synthetic (TFA preparation, HFIP treated precursor)
Protein Length	40 amino acids

Gross Weight (kg)	1.4
Launch Date	2023/02/03
Net Weight (g)	0.01
Swissprot	P05067
Target Details	Amyloid Beta Pyroglutamate 3-42
Gene Id	351
Research Area	Amyloid, Neurodegeneration, Alzheimer's Disease, Neuroscience
Antigen	Amyloid beta

Adr Code	Non-hazardous
Country Of Origin	Canada
Tarriff Code	3822.19.0030
Un Code For Transport	Non-hazardous
Unspsc Code	12352202
Shipping Temperature	Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.
Purity	>95%
Storage Buffer	10mM HCl with 2% DMSO
Storage Temperature	-80°C

Applications	In vivo assay, In vitro assay, WB

Reference	1. Stine et al. 2003. JBC. 278(13):11612-22; doi: 10.1074/jbc.M210207200<br />2. Chromy et al. 2003. Biochemistry. 42:12749-12760; doi: 10.1021/bi030029q<br />3. Panza et al. 2019. Nat Rev Neurol. 15:73-88; https://doi.org/10.1038/s41582-018-0116-6<br />4. Valverde et al. 2021. JBC. 297:100963; https://doi.org/10.1016/j.jbc.2021.100963<br />5. Schilling et al. 2008. Nat Med. 14:1106-11; DOI: 10.1038/nm.1872<br />6. Hartlage-Rubsamen et al. 2011. Acta Neuropathol. 121:705-19; 10.1007/s00401-011-0806-2<br />7. Xu, Wang and Wu. 2021. J Med Chem. 64:654965; DOI: 10.1021/acs.jmedchem.1c00325<br />8. Bayer. 2021. Nat Mol Psych. 27:1880-1885; https://doi.org/10.1038/s41380-021-01409-3

Product Manual	Datasheet

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP11901221-1	SPR-492B	100 ug	$440		Add to Cart
BHP11901221-2	SPR-492C	100 ug x2	$790		Add to Cart
BHP11901221-3	SPR-492E	100 ug x5	$1640		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.