JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide

Hainantoxin-IV

SKU : BHP21300218

A Blocker of TTX-Sensitive NaV Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STH-130, STH-130_0.1 mg, STH-130_0.25 mg, STH-130_0.5 mg, STH-130_1 mg, STH-130_10 mg, STH-130_5 mg
Description	A Blocker of TTX-Sensitive NaV Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C166H257N53O50S6
Background	Hainantoxin-IV (HNTX-IV) is a 35-amino acid peptidyl toxin originally isolated from the venom of the Chinese bird spider Ornithoctonus hainana Liang (Selenocosmia hainana Liang). HNTX-IV is a potent and selective inhibitor of TTX-sensitive NaV channels1. It has been shown to specifically inhibit the neuronal TTX-S VGSCs with an IC50 of 34 nM in adult rat dorsal root ganglion (DRG) neurons. HNTX-IV blocks neuromuscular transmission in the isolated nerve-synapse preparations of rat. HNTX-IV seems to interact with neurotoxin receptor site 1 through a mechanism quite similar to that of TTX without affecting the activation and inactivation kinetics. The toxin has six cysteine residues that form three disulfide bonds are clustered together in small peptides2.
Biological Activity	Neural TTX-sensitive voltage-gated Na+ channel inhibitor1,2.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	3987.6 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	D2Y232
Concentration	20 - 250 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys2-Cys17, Cys9-Cys24, and Cys16-Cys31 Ile35 - C-terminal amidation
Origin	Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum)

Synonyms	u-theraphotoxin-Hhn1b, u-TRTX-Hhn1b, Hainantoxin-4, HnTx-IV, Peptide F8-18.88
Gene Id	SCN1A,SCN2A,SCN3A,SCN4A,SCN8A,SCN9A
Sequence	ECLGFGKGCNPSNDQCCKSSNLVCSRKHRWCKYEI-NH2
Target	TTX-sensitive NaV channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Dongling, Li. et al. (2004) J. Biol. Chem. 279, 37734. Liu, Y. et al. (2012) J. Pept. Sci. 18, 643. Liu, Z. et al. (2003) Cell. Mol. Life Sci. 60, 972. Xiao, Y. and Liang, S. (2003) Eur. J. Pharm. 477, 1.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300218-1	STH-130_0.1 mg	0.1 mg	$130		Add to Cart
BHP21300218-2	STH-130_0.25 mg	0.25 mg	$295		Add to Cart
BHP21300218-3	STH-130_0.5 mg	0.5 mg	$533		Add to Cart
BHP21300218-4	STH-130_1 mg	1 mg	$853		Add to Cart
BHP21300218-5	STH-130_10 mg	10 mg	$5453		Add to Cart
BHP21300218-6	STH-130_5 mg	5 mg	$3409		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.