JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide

Hainantoxin-III

SKU : BHP21300217

A Potent Mammalian TTX-Sensitive Voltage-Gated Na+ Channel Blocker

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STH-120, STH-120_0.1 mg, STH-120_0.25 mg, STH-120_0.5 mg, STH-120_1 mg, STH-120_10 mg, STH-120_5 mg
Description	A Potent Mammalian TTX-Sensitive Voltage-Gated Na+ Channel Blocker
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C154H228N44O45S6
Background	Hainantoxin-III is a 33 amino acid peptidyl toxin isolated from the Haplopelma hainanum (Selenocosmia hainana, Chinese bird) tarantula spider1.Hainantoxin-III strongly depresses the amplitude of TTX-sensitive Na+ currents with IC50 value of 1.1 nM1. It causes a hyperpolarizing shift of about 10 mV in the voltage midpoint of steady-state Na+ channel inactivation and significantly decreases the recovery rate from inactivation1.The Haplopelma hainanum tarantula spider venom was recently found to be a source of various toxic components with different pharmacological properties2. 192 mature toxin sequences were identified by DNA sequencing technique. Hainantoxin-III was one of the toxins identified2.
Biological Activity	Hainantoxin-III blocks TTX-sensitive voltage-gated Na+ channels (IC50 = 1.1 nM)1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	3608 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	D2Y1Y1
Concentration	1 - 5 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29 Leu33 - C-terminal amidation
Origin	Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum)

Synonyms	u-TRTX-Hhn2a, HnTx-III, Hainantoxin-3
Gene Id	SCN1A,SCN2A,SCN3A,SCN9A
Sequence	GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL-NH2
Target	TTX-sensitive NaV Na+ channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Xiao, Y. and Liang, S. (2003) Eur. J. Pharmacol. 477, 1. Tang, X. et al. (2010) J. Proteome Res. 9, 2550. Xiao, Y. and Liang, S. (2003) Eur. J. Pharmacol. 477, 1.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300217-1	STH-120_0.1 mg	0.1 mg	$88		Add to Cart
BHP21300217-2	STH-120_0.25 mg	0.25 mg	$218		Add to Cart
BHP21300217-3	STH-120_0.5 mg	0.5 mg	$394		Add to Cart
BHP21300217-4	STH-120_1 mg	1 mg	$633		Add to Cart
BHP21300217-5	STH-120_10 mg	10 mg	$4042		Add to Cart
BHP21300217-6	STH-120_5 mg	5 mg	$2527		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.