JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide

APETx2

SKU : BHP21300125

A Blocker of ASIC3 Channel

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STA-160, STA-160_0.1 mg, STA-160_0.25 mg, STA-160_0.5 mg, STA-160_1 mg, STA-160_10 mg, STA-160_5 mg
Description	A Blocker of ASIC3 Channel
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C196H280N54O61S6
Background	Natural APETx2 is a 42-amino-acid peptidyl toxin, originally isolated from the sea anemone Anthopleura elegantissima. APETx2 was shown to be a selective, potent and reversible blocker of the homodimer proton gated channel ASIC3. ASIC3 has been implicated in pain transduction associated with acidosis in inflamed or ischemic tissues. APETx2 directly inhibits the ASIC3 channel by acting at its external side of the channel in a pH dependent manner.APETx2 also inhibits the hetromer ASIC2b-ASIC3 channel but does not inhibit the activity of ASIC1 isoform1.Structurally APETx2 is related to APETx1 a toxin that targets HERG K+ channel1,2.
Biological Activity	APETx2 inhibits ASIC3 channels1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	4561 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P61542
Concentration	10 nM - 3 uM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
Cas Number	713544-47-9
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38
Origin	Anthopleura elegantissima (Green aggregating anemone) (Actinia elegantissima)

Synonyms	Toxin APETx2, Pi-AITX-Ael2b, Pi-actitoxin-Ael2b
Gene Id	ASIC3 ,KCNH2,SCN10A,SCN2A
Sequence	GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD-OH
Target	ASIC3 channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Diochot, S. et al. (2004) EMBO J. 23, 1516. Chagot, B. et al. (2005) Protein Sci. 14, 2003. Gao, M. et al. (2016) Eur. J. Ortho. 38, 577. Yan, J. et al. (2013) Headache 53, 1250. Izumi, M. et al. (2012) J. Biomed. Sci. 19, 77. Chagot, B. et al. (2005) Protein Sci. 14, 2003.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300125-1	STA-160_0.1 mg	0.1 mg	$96		Add to Cart
BHP21300125-2	STA-160_0.25 mg	0.25 mg	$235		Add to Cart
BHP21300125-3	STA-160_0.5 mg	0.5 mg	$438		Add to Cart
BHP21300125-4	STA-160_1 mg	1 mg	$659		Add to Cart
BHP21300125-5	STA-160_10 mg	10 mg	$5332		Add to Cart
BHP21300125-6	STA-160_5 mg	5 mg	$2963		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.