JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Wasabi Receptor Toxin

SKU : BHP21300310

A Cell-Penetrating Activator of TRPA1 Channel

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STW-200, STW-200_0.1 mg, STW-200_0.5 mg, STW-200_1 mg, STW-200_10 mg, STW-200_5 mg
Description	A Cell-Penetrating Activator of TRPA1 Channel
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C164H245N45O53S5
Background	Wasabi receptor toxin (WaTx) is a peptide toxin originally isolated from Urodacus manicatus (Australian Black Rock scorpion) venoM The peptide toxin activates TRPA1 channel by a novel mechanism: it penetrates the cell and stabilizes the channel's open state, thereby causing pain1.TRPA1 ion channel is a chemosensory receptor for a broad class of volatile environmental irritants. It is expressed in sensory neurons and activated by natural products from mustard and allium plants. This activation elicits the sinus clearing or eye stinging pain one experiences when eating wasabi or chopping an onion2.TRPA1 is also a sensor for endogenous inflammatory agents that directly activate this channel to produce acute and persistent pain2. TRPA1 is considered a promising therapeutic target for treating chronic pain, itch, and neurogenic inflammatory syndromes3.
Biological Activity	Wasabi Receptor Toxin is a cell penetrating peptide toxin activator of TRPA1 Channel1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	3855.3 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	C0HLG4
Concentration	0.5 - 5 uM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
Cas Number	2569291-86-5
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys44-Cys62, Cys48-Cys58
Origin	Urodacus manicatus (Black rock scorpion)

Synonyms	WaTx
Gene Id	TRPA1
Sequence	ASPQQAKYCYEQCNVNKVPFDQCYQMCSPLERS-OH
Target	TRPA1 channel

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	King, J.V.L. et al. (2019) Cell 178, 1362. Bandell, M. et al. (2004) Neuron 41, 849. Bautista, D.M. et al. (2013) Annu. Rev. Physiol. 75, 181.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300310-1	STW-200_0.1 mg	0.1 mg	$359		Add to Cart
BHP21300310-2	STW-200_0.5 mg	0.5 mg	$856		Add to Cart
BHP21300310-3	STW-200_1 mg	1 mg	$1199		Add to Cart
BHP21300310-4	STW-200_10 mg	10 mg	$5639		Add to Cart
BHP21300310-5	STW-200_5 mg	5 mg	$4187		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.