JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

VSTX3

SKU : BHP21300299

A Blocker of NaV1.3, NaV1.7, NaV1.8 Voltage-Gated Na+ Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STT-350, STT-350_0.1 mg, STT-350_0.5 mg, STT-350_1 mg, STT-350_10 mg, STT-350_5 mg, STT-350_50 mcg
Description	A Blocker of NaV1.3, NaV1.7, NaV1.8 Voltage-Gated Na+ Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C182H261N51O51S6
Background	VSTX3 was originally isolated from the Grammostola spatulata spider venom1 and is also isolated from the Phrixotrichus auratus spider venom2.VSTX3 was first isolated and shown to bind through its affinity to the voltage-sensor domain of KvAP channels1.VSTX3 also inhibits voltage-gated rat NaV1.3, NaV1.7 and NaV1.8 Na+ channels2.Voltage-gated sodium channels (VGSC, NaV) play a critical role in excitability of nociceptors (pain-sensing neurons). The peripheral-specific sodium channels NaV1.7, NaV1.8 and NaV1.9 are particularly important in the pathophysiology of different pain syndromes and hence, thought to be potential targets for pain therapeutics3,4.The expression and functional properties of NaV channels in peripheral sensory neurons can be dynamically regulated following axonal injury or peripheral inflammation5.VSTX3 shows high homology to Ceratotoxin-1 (75%), Ceratotoxin-2 (#STC-100) (77%) and Pterinotoxin-1 (#STT-100) (83%).
Biological Activity	VSTX3 inhibits voltage-gated Na+ channels NaV1.3, NaV1.7 and NaV1.81.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	4171.8 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P0C2P5
Concentration	200 - 500 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29
Origin	Grammostola rosea (Chilean rose tarantula) (Phrixotrichus auratus)(Grammostola spatulata)

Synonyms	kappa-Theraphotoxin-Gr4a, Kappa-TRTX-Gr4a, Voltage sensor toxin 3, Peptide F
Gene Id	SCN10A,SCN3A,SCN9A
Sequence	DCLGWFKGCDPDNDKCCEGYKCNRRDKWCKYKLW-OH
Target	NaV1.3, NaV1.7, NaV1.8 Na+ channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Ruta, V. and MacKinnon, R. (2004) Biochemistry 43, 10071. Meir, A. et al. (2011) Novel peptides isolated from spider venom, and uses thereof. U.S. Patent Application Publication # US 2011/0065647 A1. Sheets, P.L. et al. (2008) J. Pharmacol. Exp. Ther. 326, 89. Zimmermann, K. et al. (2007) Nature 447, 855. Amir, E. et al. (2006) J. Pain 7, S1. Meir, A. et al. (2011) Novel peptides isolated from spider venom, and uses thereof. U.S. Patent Application Publication # US 2011/0065647 A1.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300299-1	STT-350_0.1 mg	0.1 ml	$406		Add to Cart
BHP21300299-2	STT-350_0.5 mg	0.5 mg	$1217		Add to Cart
BHP21300299-3	STT-350_1 mg	1 mg	$1659		Add to Cart
BHP21300299-4	STT-350_10 mg	10 mg	$7042		Add to Cart
BHP21300299-5	STT-350_5 mg	5 mg	$4967		Add to Cart
BHP21300299-6	STT-350_50 mcg	50 mcg	$287		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.