JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

u-TRTX-Df1a

SKU : BHP21300201

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STD-050, STD-050_0.1 mg, STD-050_0.5 mg, STD-050_50 mcg
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C180H246N54O45S6
Background	u-TRTX-Df1a (Df1a) is a 34-amino acid peptide toxin originally isolated from the venom of the tarantula Davus fasciatus. This toxin has been identified as a potent blocker of voltage-gated sodium (NaV) and calcium (CaV)3 channels1. Df1a exhibits a rank order of potency for hNaV channels as follows: 1.7 > 1.2 > 1.3 > 1.6 > 1.1 > 1.4 > 1.5, and for hCaV3 channels, the order is 3.1 > 3.3 > 3.2. Additionally, Df1a demonstrates a dual modulatory effect by simultaneously inhibiting peak current and slowing fast inactivation of NaV1.1, NaV1.3, and NaV1.5 subtypes. It also alters the voltage dependence of activation and inactivation for most NaV subtypes1. Df1a belongs to the Family 2 of NaV-targeting spider toxins (NaSpTx), characterized by an inhibitor cystine knot (ICK) motif and highly conserved N- and C-terminal regions1. ICK peptides possess a disulfide-rich structural framework that creates a "knot," imparting exceptional structural, thermal, and proteolytic stability. CaV3 are T-type, low voltage-gated calcium channels. Their electrophysiological properties include low voltage thresholds for activation and inactivation, rapid inactivation, and rebound bursting. These properties are responsible for the CaV3-mediated fine-tuned regulation of neuronal excitability in both the central nervous system (CNS) and peripheral nervous system (PNS)2. Nav channels are involved in a wide array of physiological processes. There are nine mammalian subtypes of voltage-gated sodium (NaV) channels: NaV1.1NaV1.9. They are transmembrane proteins responsible for propagating action potentials in excitable cells, most notably nerves and muscle. These channels are considered to be important therapeutic targets for a wide variety of pathophysiological conditions such as chronic pain, cardiac arrhythmia, and epilepsy3,4. Df1a acted as an analgesic in vivo, alleviating the spontaneous pain behaviors triggered by the NaV activator OD11.
Biological Activity	Df1a exhibits a rank order of potency for hNaV channels as follows: 1.7 > 1.2 > 1.3 > 1.6 > 1.1 > 1.4 > 1.5, and for hCaV3 channels, the order is 3.1 > 3.3 > 3.2. Also, Df1a demonstrates a dual modulatory effect by simultaneously inhibiting peak current and slowing fast inactivation of NaV1.1, NaV1.3, and NaV1.5 subtypes1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	4078.6 Da
Solubility	Soluble in water. For long-term storage in solution, we recommend to prepare a stock solution by dissolving the product in double distilled water (ddH2O) at a concentration X100-1000 of final working solution. Divide the solution into small aliquots and store at -20°C. Upon use, thaw the relevant vial intended for use and dilute in your desired working buffer. The preparation of fresh solutions in working buffers before use is recommended. Repeat freeze-thawing might result in loss of activity. Centrifuge all product preparations before use (10000 x g, 5 min)
Source	Synthetic peptide
Accession Number	P0DPC2
Concentration	20 nM 0.5 uM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds location- Cys2-Cys16, Cys9-Cys21, Cys15-Cys28 Phe34 - C-terminal amidation
Origin	Davus fasciatus (Costa Rican tiger rump) (Cyclosternum fasciatus)

Synonyms	Mu-TRTX- Df1a, Mu-theraphotoxin-Df1a, Df1a
Gene Id	SCN2A,SCN3A,SCN5A,SCN8A,SCN9A, CACNA1G, CACNA1H, CACNA1I
Sequence	ECRWFLGGCSGGQTCCEHLVCHRKHQWCVWDWSF NH2
Target	NaV channels and T-type Ca2+ channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the toxin in working solutions for longer than a few days. Avoid multiple freeze- thaw cycles.

Applications	Electrophysiology

Reference	Cardoso, F.C. et al. (2017) Br. J. Pharmacol. 174, 2528. Lory, P. et al. (2020) Pflugers Arch Eur. J. Physiol. 472, 831. Chow, C.Y. et al. (2015) Toxins 7, 2494. Klint J.K. et al. (2015) Br. J. Pharmacol. 172, 2445.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300201-1	STD-050_0.1 mg	0.1 mg	$966		Add to Cart
BHP21300201-2	STD-050_0.5 mg	0.5 mg	$3378		Add to Cart
BHP21300201-3	STD-050_50 mcg	50 mcg	$585		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.