JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Tf2 Toxin

SKU : BHP21300288

An Opener of NaV1.3 and NaV1.9 Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STT-050, STT-050_0.1 mg, STT-050_0.25 mg, STT-050_0.5 mg, STT-050_1 mg, STT-050_10 mg, STT-050_5 mg
Description	An Opener of NaV1.3 and NaV1.9 Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C309H438N80O87S9
Background	Tf2 Toxin is a beta-scorpion peptide toxin originally isolated from the venom of the Brazilian scorpion Tityus fasciolatus. Tf2 Toxin acts as a NaV1.3 channel opener. It shifts human NaV1.3 channel voltage activation towards negative values and effectively opens the channel at resting membrane potentials1. The toxin was also found to open NaV1.9 channels4.NaV channels are integral membrane proteins that allow movement of Na+ ions across cellular membranes. in response to local membrane depolarization these channels mediate the influx of Na+ ions2,3.NaV1.3 channel is encoded by the Scn3A gene and is expressed in peripheral nociceptive neurons of dorsal root ganglion, in the developing nervous system and in pancreatic islet cells2. Abnormalities in Scn3A gene expression are associated with epilepsy, mental retardation, autism, and neuropathic pain3.
Biological Activity	Tf2 Toxin is a NaV1.3 and NaV1.9 channel opener1,2.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	6954 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic protein
Accession Number	C0HJM9
Concentration	1 uM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys11-Cys62, Cys15-Cys38, Cys23-Cys43, Cys27-Cys45 Cys62 - C-terminal amidation
Origin	Tityus fasciolatus (Central Brazilian scorpion)

Synonyms	Tf2 scorpion toxin
Gene Id	SCN11A,SCN3A
Sequence	KEGYAMDHEGCKFSCFIRPSGFCDGYCKTHLKASSGYCAWPACYCYGVPSNIKVWDYATNKC-NH2
Target	NaV1.3, NaV1.9 channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Camargos, T.S. et al. (2015) PLoS ONE 10, e0128578. Yang, L. et al. (2016) Int. J. Mol. Sci. 17, 9. Su, S. et al. (2017) Front. Mol. Neurosci. 10, 126. Israel, M.R. et al. (2020) Biomedicines 8, 155. Camargos, T.S. et al. (2015) PLoS ONE 10, e0128578.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300288-1	STT-050_0.1 mg	0.1 mg	$163		Add to Cart
BHP21300288-2	STT-050_0.25 mg	0.25 mg	$351		Add to Cart
BHP21300288-3	STT-050_0.5 mg	0.5 mg	$595		Add to Cart
BHP21300288-4	STT-050_1 mg	1 mg	$1019		Add to Cart
BHP21300288-5	STT-050_10 mg	10 mg	$5376		Add to Cart
BHP21300288-6	STT-050_5 mg	5 mg	$3360		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.