JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Tamapin

SKU : BHP21300302

A Blocker of KCa2 Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STT-400, STT-400_0.1 mg, STT-400_0.25 mg, STT-400_0.5 mg, STT-400_1 mg, STT-400_10 mg, STT-400_5 mg
Description	A Blocker of KCa2 Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C146H238N44O41S6
Background	Tamapin is a 31 amino acid peptidyl toxin, isolated from the venom of the Indian red scorpion, Mesobuthus tamulus, and is classified as alpha-5.4 scorpion toxin family1 with three disulfide bridges. Native Tamapin blocks KCa2 channels in pyramidal neurons of the hippocampus as well as in cell lines expressing distinct KCa2 channel subunits. Tamapin displays a remarkable selectivity for KCa2.2 (SK2/KCNN2, IC50 = 24 pM) versus KCa2.1 (SK1/KCNN1, approx 1750 fold) and KCa2.3 (SK3/KCNN3) channels2.
Biological Activity	Tamapin blocks KCa2 channels. Tamapin displays a remarkable selectivity for KCa2.2 versus KCa2.1 channels1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	3458.2 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P59869
Concentration	500 pM - 50 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
Cas Number	508220-81-3
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys3-Cys21, Cys8-Cys26, and Cys12-Cys28 Tyr31 - C-terminal amidation
Origin	Hottentotta tamulus (Eastern Indian scorpion) (Mesobuthus tamulus)

Synonyms	K+ channel toxin alpha-KTx 5.4
Gene Id	KCNN1,KCNN2,KCNN3
Sequence	AFCNLRRCELSCRSLGLLGKCIGEECKCVPY-NH2
Target	KCa2 K+ channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Rodriguez de la Vega, R.C. and Possani, L.D. (2004) Toxicon 43, 865. Pedarzani, P. et al. (2002) J. Biol. Chem. 277, 46101. Pedarzani, P. et al. (2002) J. Biol. Chem. 277, 46101.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300302-1	STT-400_0.1 mg	0.1 mg	$152		Add to Cart
BHP21300302-2	STT-400_0.25 mg	0.25 mg	$328		Add to Cart
BHP21300302-3	STT-400_0.5 mg	0.5 mg	$525		Add to Cart
BHP21300302-4	STT-400_1 mg	1 mg	$839		Add to Cart
BHP21300302-5	STT-400_10 mg	10 mg	$5362		Add to Cart
BHP21300302-6	STT-400_5 mg	5 mg	$3351		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.