JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Stromatoxin-1

SKU : BHP21300276

A Potent Blocker of KV2.1, KV2.2, KV4.2 and KV9.3 Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STS-350, STS-350_0.1 mg, STS-350_0.25 mg, STS-350_0.5 mg, STS-350_1 mg, STS-350_10 mg, STS-350_5 mg, STS-350_50 mcg
Description	A Potent Blocker of KV2.1, KV2.2, KV4.2 and KV9.3 Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C156H237N49O48S7
Background	Stromatoxin-1 is a 34 amino acid peptidyl toxin originally isolated from Stromatopelma calceatum tarantula1. Structurally, Stromatoxin-1 belongs to the scaffold of structural inhibitor cysteine knot peptide family, which were shown to function as gating modifiers2.Stromatoxin-1 selectively inhibits KV2.1, KV2.1/9.3, and KV4.2 channel currents (IC50 of 12.7 nM, 7.2 nM and 1.2 nM respectively), and is the first high-affinity voltage gating modifier inhibitor of the KV2.2 channel subtype (IC50, 21.4 nM) to be discovered1.
Biological Activity	Stromatoxin-1 is a potent inhibitor of voltage-gated K+ channels. It inhibits delayed KV2.1, KV2.1/9.3, KV2.2, and transient KV4.2 channels1,2.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	3791.4 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P60991
Concentration	1.2 - 670 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Cited Application: Electrophysiology Is Toxin: Yes
Cas Number	741738-59-0
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys2-Cys16, Cys9-Cys21 and Cys15-Cys28 Ile34 - C-terminal amidation
Origin	Stromatopelma calceatum (Featherleg baboon tarantula) (Scodra calceata)

Synonyms	kappa-Theraphotoxin-Sc1a, kappa-TRTX-Sc1a, ScTx1
Gene Id	KCNB1,KCNB2 ,KCND2,KCNS3
Sequence	DCTRMFGACRRDSDCCPHLGCKPTSKYCAWDGTI-NH2
Target	Various KV channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Escoubas, P. et al. (2002) Mol. pharmacol. 62, 48. Shiau, Y.S. et al. (2003) Chem. Res. Toxiol. 16, 1217. Shiau, Y.S. et al. (2003) Chem. Res. Toxiol. 16, 1217.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300276-1	STS-350_0.1 mg	0.1 mg	$152		Add to Cart
BHP21300276-2	STS-350_0.25 mg	0.25 mg	$303		Add to Cart
BHP21300276-3	STS-350_0.5 mg	0.5 mg	$544		Add to Cart
BHP21300276-4	STS-350_1 mg	1 mg	$989		Add to Cart
BHP21300276-5	STS-350_10 mg	10 mg	$6308		Add to Cart
BHP21300276-6	STS-350_5 mg	5 mg	$3943		Add to Cart
BHP21300276-7	STS-350_50 mcg	50 mcg	$130		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.