JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

SsTx Toxin

SKU : BHP21300286

A Blocker of KCNQ and KV1.3 Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STS-700, STS-700_0.25 mg, STS-700_0.5 mg, STS-700_1 mg, STS-700_10 mg, STS-700_5 mg
Description	A Blocker of KCNQ and KV1.3 Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C270H413N69O79S4
Background	SsTx Toxin is a peptide toxin originally isolated from the Chinese red-headed centipede venoM SsTx structure consists of amino acids in position 12 and 13 which form a positively charged surface and two disulphide bridges. It is the first peptide toxin found to potently and selectively block KCNQ (KV7) channels, members of voltage-gated potassium (KV) channel family1 with IC50 values of 2.5, 2.8, 2.7, and 2.7 uM for KCNQ4, KCNQ1, KCNQ2, and KCNQ5 respectively1. The toxin also blocks KV1.3 channel with an IC50 value of ~5 uM3.SsTx blocks progressively less when the membrane potential becomes more depolarized, and high K+ concentrations increase the IC50 values, suggesting that the toxin binds to the outer pore domain of KCNQ channels1.KCNQ is a family of multifunctional K+ channels that are involved in a variety of physiological functions, including cardiac action potential repolarization, coronary circulation and reactive hyperemia, and cerebral neuron excitation. These channels are considered to be potential therapeutic targets for a variety of neuronal disorders1,2.
Biological Activity	Blocks voltage-gated potassium channels KCNQ4, KCNQ1, KCNQ2 and KCNQ51 and KV1.32.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	6018 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic protein
Accession Number	A0A2L0ART2
Concentration	2 - 5 uM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys20-Cys46 and Cys24-Cys48
Origin	Scolopendra mutilans (Chinese red-headed centipede) (Scolopendra subspinipes mutilans)

Synonyms	Potassium channel toxin SsTx, Ssm spooky toxin, Mu-scoloptoxin(15)-Ssm1a, Mu-SLPTX(15)-Ssm1a
Gene Id	KCNQ1,KCNQ2,KCNQ4,KCNQ5,KCNA3
Sequence	EVIKKDTPYKKRKFPYKSECLKACATSFTGGDESRIQEGKPGFFKCTCYFTTG-OH
Target	KCNQ1, KCNQ2, KCNQ4, KCNQ5, KV1.3 channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Luo, L. et al. (2018) Proc. Natl. Acad. Sci. U.S.A. 115, 1646. Wang, J.J. and Li, Y. (2016) Acta Pharmacol. Sin. 37, 25. Du, C. et al. (2019) Toxins (Basel) 11, 76. Luo, L. et al. (2018) Proc. Natl. Acad. Sci. U.S.A. 115, 1646. Du, C. et al. (2019) Toxins (Basel) 11, 76.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300286-1	STS-700_0.25 mg	0.25 mg	$235		Add to Cart
BHP21300286-2	STS-700_0.5 mg	0.5 mg	$337		Add to Cart
BHP21300286-3	STS-700_1 mg	1 mg	$543		Add to Cart
BHP21300286-4	STS-700_10 mg	10 mg	$3023		Add to Cart
BHP21300286-5	STS-700_5 mg	5 mg	$1885		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.