JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

SNX-482

SKU : BHP21300106

A Blocker of CaV2.3 and KV4.3 Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	RTS-500, RTS-500_0.1 mg, RTS-500_0.25 mg, RTS-500_0.5 mg, RTS-500_1 mg, RTS-500_2.5 mg, RTS-500_5 mg, RTS-500_50 mcg
Description	A Blocker of CaV2.3 and KV4.3 Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C192H274N52O60S7
Background	SNX-482 is a peptidyl toxin originally isolated from venom of the spider Hysterocrates gigas. Native SNX-482 blocks specifically CaV2.3 (alpha1E, R-type) channels1 in a voltage-dependent manner. The block is reversible only upon application of strong voltage to facilitate unbinding.2 SNX-482 inhibits human CaV2.3 channels stably expressed in a mammalian cell line. An IC50 of 15-30 nM was obtained for block of CaV2.3 channel, using either patch clamp electrophysiology or K+-evoked Ca2+ flux. At low nanomolar concentrations, SNX-482 also blocked a native R-type Ca2+ current in rat neurohypophyseal nerve terminals, but concentrations of 200-500 nM had no effect on R-type Ca2+ currents in several types of rat central neurons.1 SNX-482 was also used to demonstrate the contribution of CaV2.3 channels to transmitter release.3 Recently it was shown that higher concentrations of SNX-482 also block CaV2.1 channels in chromaffin cells.4SNX-482 was found to be the most potent blocker to date for KV4.3 channel with IC50 < 3 nM5.
Biological Activity	SNX-482 blocks R-type (CaV2.3) and P/Q-type (CaV2.1) voltage-gated Ca2+ channels1. It also blocks A-type K+ channels with an IC50 < 3 nM2.
Formulation	Lyophilized from filtrated Ammonium acetate solution. May contain acetate as a residual counter ion.
Molecular Weight	4495 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Recombinant, E. coli
Accession Number	P56854
Concentration	10 - 100 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Cited Application: Electrophysiology Is Toxin: Yes
Cas Number	203460-30-4
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys7-Cys21, Cys14-Cys26, and Cys20-Cys33
Origin	Hysterocrates gigas (Cameroon red baboon tarantula)

Synonyms	omega-Theraphotoxin-Hg1a, omega-TRTX-Hg1a, SNX 482
Gene Id	CACNA1A, CACNA1E, KCND2, KCND3
Sequence	GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD-OH
Target	CaV2.3, CaV2.1, KV4.2, KV4.3 channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Bourinet, E. et al. (2001) Biophys. J. 81, 79. Wang, G. et al. (1999) J. Neurosci. 19, 9235. Arroyo, G. et al. (2003) Eur. J. Pharmacol. 475, 11. Kimm, T. and Bean, B.P. (2014) J. Neurosci. 34, 9182. Newcomb, R. et. al. (1998) Biochemistry 37, 15353. Kimm, T. and Bean, B.P. (2014) J. Neurosci. 34, 9182. Bourinet, E. et al. (2001) Biophys. J. 81, 79.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300106-1	RTS-500_0.1 mg	0.1 mg	$218		Add to Cart
BHP21300106-2	RTS-500_0.25 mg	0.25 mg	$471		Add to Cart
BHP21300106-3	RTS-500_0.5 mg	0.5 mg	$753		Add to Cart
BHP21300106-4	RTS-500_1 mg	1 mg	$1357		Add to Cart
BHP21300106-5	RTS-500_2.5 mg	2.5 mg	$3050		Add to Cart
BHP21300106-6	RTS-500_5 mg	5 mg	$5490		Add to Cart
BHP21300106-7	RTS-500_50 mcg	50 mcg	$152		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.