JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Recombinant human proNGF protein

SKU : BHP21300083

Human proNerve Growth Factor, Recombinant, E. coli

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	N-280, N-280_0.1 mg, N-280_0.25 mg, N-280_0.5 mg, N-280_1 mg, N-280_10 mcg, N-280_2 mcg, N-280_25 mcg, N-280_5 mcg, N-280_50 mcg
Description	Human proNerve Growth Factor, Recombinant, E. coli
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. Repeated freeze-thaw cycles may result in loss of activity.
Background	The proneurotrophins (proNT) are, as their name suggests, the proform of the neurotrophins. The neurotrophins (NT) are a family of soluble, basic growth factors which regulate neuronal development, maintenance, survival and death in the CNS and the PNS.1 They exert their biological effects by binding to two types of receptors: the Trk receptors, and the p75NTR receptor.Like many other proteins, mature NT arise from the proteolytic cleavage of the precursor form by various proteases: plasmin, furin, MP7, PC1/3, PC2, PC5/6, PC7 and PACE4, which cut behind a pair or even a single basic residue.2 This has been known for many years, and it was thought that the roles of the prodomain were to aid in the folding of the mature protein and to sort the mature neurotrophin into the various secretion pathways.3 However, recently an assortment of papers have been published which suggest new roles for the proNT. It has been found that proNerve Growth Factor (proNGF), and not mature NGF, is the predominant isoform found in the human brain as well as in a variety of cell types, including mast cells, sciatic nerve cells, thyroid gland, skeletal muscle, prostate gland, hippocampus and hair follicle.4 Thus, the case of the mouse salivary gland, which is the most abundant source of mature NGF, seems to be the exception and not the rule.proNGF is the ligand preferred by p75NTR.5 Therefore, cleavage resistant proNGF (mutated at the cleavage site to insure that it retains the prodomain) induced apoptosis ten times more effectively than mature NGF in a vascular smooth muscle cell line expressing p75NTR but not Trk receptors.5 However, proNGF can also mediate survival. Rattenholl et al. have shown that proNGF was as effective as NGF in inducing survival of DRG neurons.3 Fahnestock et al. have shown that a mutated proNGF exhibits neurite outgrowth on both PC12 cells and mouse sympathetic cervical ganglions.6A neccesary but not sufficient partner for proNGF is sortilin, a 95 kDa member of the Vps10p domain receptor family which is expressed in a variety of tissues, notably brain, spinal tissue and muscle. However, not all cells expressing p75NTR and sortilin react to proNGF by becoming apoptotic. For example, in mature pig oligodendrocytes, which express p75NTR and sortilin, proNGF induces survival.7A close analysis of the literature shows that there are at least four types of proNGF which have been used in biological assays. One, produced in mammalian cell culture, contains two mutations at the furin cleavage site, two mutations at the C-terminus, and the addition of a C-terminal His tag.5 A second proNGF, produced in baculovirus, has only one mutation, at the cleavage site.6 A third proNGF has been purified from the brains of Alzheimer's patients, and is highly glycosylated.8 A fourth, with no mutations, has been expressed and purified from E.coli.3 The large variation between results obtained may be due to the different types of preparations assayed. Another crucial issue is the cell type and origin. Even in cells of the same type, for example, in oligodendrocytes: opposing effects of proNGF were seen in rat oligodendrocytes where it caused apoptosis,9 however, in pig oligodendrocytes it induced survival.7 It should be noted that rat and pig oligodendrocytes do not express the same panel of receptors: rat oligodendrocytes do not express TrkA whereas pig (and human) oligodendrocytes do.
Biological Activity	proNGF is the preferred ligand of p75NTR 1. In contrast to its mature form proNGF induces apoptosis via p75NTR 1, but can also mediate cell survival in DRGs2.
Formulation	Lyophilized from filtrated Ammonium acetate solution. May contain acetate as a residual counter ion.
Molecular Weight	50.2 kDa (dimer)
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. Repeat freeze-thawing may result in loss of activity.
Source	Recombinant, E. coli
Concentration	0.4 - 4 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: yes Is Toxin: No
UNSPSC Code	12352202
Lead Time	1-2 Business Days

Synonyms	proNerve Growth Factor
Gene Id	NGFR, NTRK1, SORT1, SORCS2
Sequence	MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA (shown in bold is the prodomain)S
Target	p75NTR, VPS10 domain-containing receptors

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Neurite outgrowth assay, Cell survival assay

Reference	Roux, P.P. and Barker, P.A. (2002) Prog. Neurobiol. 67, 203. Lessmann, V. et al. (2003) Prog. Neurobiol. 69, 341. Rattenholl, A. et al. (2001) Eur. J. Biochem. 268, 3296. Hasan, W. et al. (2003) J. Neurobiol. 57, 38. Lee, R. et al. (2001) Science 294, 1945. Fahnestock, M. et al. (2004) J. Neurochem. 89, 581. Althaus, H.H. and Kloppner, S. (2006) J. Neurochem. 98, 506. Pedraza C.E. et al. (2005) Am. J. Pathol. 166, 533. Beattie, M.S. et al. (2002) Neuron 36, 375. Lee, R. et al. (2001) Science 294, 1945. Rattenholl, A. et al. (2001) Eur. J. Biochem. 268, 3296.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300083-1	N-280_0.1 mg	0.1 mg	$1132		Add to Cart
BHP21300083-2	N-280_0.25 mg	0.25 mg	$1582		Add to Cart
BHP21300083-3	N-280_0.5 mg	0.5 mg	$2295		Add to Cart
BHP21300083-4	N-280_1 mg	1 mg	$3231		Add to Cart
BHP21300083-5	N-280_10 mcg	10 mcg	$184		Add to Cart
BHP21300083-6	N-280_2 mcg	2 mcg	$66		Add to Cart
BHP21300083-7	N-280_25 mcg	25 mcg	$425		Add to Cart
BHP21300083-8	N-280_5 mcg	5 mcg	$151		Add to Cart
BHP21300083-9	N-280_50 mcg	50 mcg	$627		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.