JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Recombinant human Neurotrophin-4 (NT-4) protein

SKU : BHP21300082

Human Neurotrophin-4, Recombinant, E. coli

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	N-270, N-270_0.1 mg, N-270_0.25 mg, N-270_0.5 mg, N-270_1 mg, N-270_10 mcg, N-270_25 mcg, N-270_5 mcg, N-270_50 mcg
Description	Human Neurotrophin-4, Recombinant, E. coli
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeated freeze-thaw cycles may result in loss of activity.
Background	The neurotrophins ("neuro" means nerve and "trophe" means nutrient) are a family of soluble, basic growth factors which regulate neuronal development, maintenance, survival and death in the CNS and PNS.1Neurotrophin-4 (NT-4) is expressed in neurons of the superior cervical, stellate and celiac ganglion,2 T-cells3 and is synthesized by keratinocytes.4The structural hallmark of all the neurotrophins is the characteristic arrangement of the disulfide bridges known as the cysteine knot, which has been found in other growth factors such as PDGF.5The rat and human forms of NT-4 are 96% homologous. NT-4 has been shown to promote dendritic outgrowth and calcium currents in cultured mesencephalic dopamine neurons,6 to promote growth and remodeling of adult motor neuron innervation,7 to be anterograde survival factors for postsynaptic cells8 and to protect against apoptotic neuronal death.9The biological effects of NT-4 are mediated by two receptors: TrkB which is specific for NT-4 and BDNF, and p75NTR which binds all the neurotrophins.10
Biological Activity	NT-4 is involved in many biological outcomes including promoting dendritic outgrowth and Ca2+ currents in cultured mesencephalic dopamine neurons1, promoting growth and remodeling of adult motor neuron innervation2. The biological effects of NT-4 are mediated by two receptors: TrkB which is specific for NT-4 and BDNF, and p75NTR which binds all the neurotrophins3.
Formulation	Lyophilized from filtrated Ammonium acetate solution. May contain acetate as a residual counter ion.
Molecular Weight	28.1 kDa (dimer)
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeat freeze-thawing may result in loss of activity.
Source	Recombinant, E. coli
Accession Number	P34130
Concentration	1 - 10 ng/ml
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: yes Is Toxin: No
UNSPSC Code	12352202
Lead Time	1-2 Business Days

Synonyms	Neutrophic factor 4, NT-4, Neurotrophin-5 (NT-5)
Gene Id	NTRK2, NGFR
Sequence	MGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA
Target	p75NTR, TrkB receptors

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Western blot

Reference	Roux, P. et al. (2002) Prog. Neurobiol. 67, 203. Moalem, G. et al. (2000) J. Autoimmun. 15, 331. Marconi, A. et al. (2003) J. Invest. Dermatol. 121, 1515. McDonald, N.Q. et al. (1991) Nature 354, 411. DeFazio, R.A. et al. (2000) Neuroscience 99, 297. Belluardo, N. et al. (2001) Mol. Cell Neurosci. 18, 56. Spalding, K.L. et al. (2002) Mol. Cell Neurosci. 19, 485. Lobner, D. and Ali, C. (2002) Brain Res. 954, 42. Teng, K.K. and Hempstead, B.L. (2004) Cell Mol. Life Sci. 61, 35. DeFazio, R.A. et al. (2000) Neuroscience 99, 297. Belluardo, N. et al. (2001) Mol. Cell Neurosci. 18, 56. Teng, K.K. and Hempstead, B.L. (2004) Cell Mol. Life Sci. 61, 35.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300082-1	N-270_0.1 mg	0.1 mg	$730		Add to Cart
BHP21300082-2	N-270_0.25 mg	0.25 mg	$1275		Add to Cart
BHP21300082-3	N-270_0.5 mg	0.5 mg	$2513		Add to Cart
BHP21300082-4	N-270_1 mg	1 mg	$4019		Add to Cart
BHP21300082-5	N-270_10 mcg	10 mcg	$134		Add to Cart
BHP21300082-6	N-270_25 mcg	25 mcg	$297		Add to Cart
BHP21300082-7	N-270_5 mcg	5 mcg	$85		Add to Cart
BHP21300082-8	N-270_50 mcg	50 mcg	$537		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.