JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Recombinant human LIF protein

SKU : BHP21300069

Human Leukemia Inhibitory Factor, Recombinant, E. coli

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	L-200, L-200_0.1 mg, L-200_0.25 mg, L-200_0.5 mg, L-200_1 mg, L-200_10 mcg, L-200_5 mcg, L-200_50 mcg
Description	Human Leukemia Inhibitory Factor, Recombinant, E. coli
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeated freeze-thaw cycles may result in loss of activity.
Background	Leukemia inhibitory factor (LIF) was identified by its ability to induce terminal differentiation in leukemic cells.1,2 LIF is a pleiotrophic factor with known actions in the immune system, the nervous system and the reproductive systeM3,4In the nervous system it acts on cultured sympathetic neurons to direct a change in neurotransmitter expression from a noradrenergic to a cholinergic phenotype and regulates the expression of neuropeptide transmitters in these cells.5,6In the immune system LIF plays a key role in inflammation,7,8 with a pro-inflammatory role in rheumatoid arthritis,9 but also with proposed anti-inflammatory properties in lung inflammatory processes.In the reproductive system, LIF appears to play an important role in implantation and in the establishment of pregnancy.10,12 LIF acts as a trophic factor for oligodendrocytes and promotes astrocytic survival and differentiation.13,14 It exhibits activity towards spinal motor neurons and stimulate the biosynthesis of acetylcholine.6LIF also functions as a trophic factor for peripheral sensory neurons supporting their survival.15,16 LIF appears to be essential for injury-induced neuropeptide synthesis17 and can also stimulate the hypothalamic-pituitary-adrenal axis in response to stress and disease.18 LIF is used extensively in experimental biology because of its ability to induce embryonic stem cells to retain their totipotentiality.
Biological Activity	LIF is a lymphoid factor which promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. LIF regulates cholinergic, peptidergic and noradrenergic properties of sympathetic neurons and rescues sensory and motor neurons from death. LIF also promotes differentiation of O-2A astrocytes1-4.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	19.7 kDa
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeat freeze-thawing may result in loss of activity.
Source	Recombinant, E. coli
Accession Number	P15018
Concentration	EC50 = ~10 pM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: No
UNSPSC Code	12352202
Lead Time	1-2 Business Days

Synonyms	Leukemia Inhibitory Factor
Gene Id	LIFR, IL6ST
Sequence	SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF-OH
Target	LIF receptor (LIFR-alpha)

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Western blot

Reference	Brach, M.A. et al. (1990) Leukemia 4, 646. Estrov, Z. et al. (1992) Leuk. Lymphoma 8, 1. Gough, N.M. et al. (1989) Cancer Cells. 1, 77. Metcalf, D. (2003) Stem Cells 21, 5. Zurn, A.D. and Werren, F. (1994) Dev. Biol. 163, 309. Martinou, J.C. et al. (1992) Neuron 8, 737. Gadient, R.A. and Patterson, P.H. (1999) Stem Cells 17, 127. Patterson, P.H. (1994) Proc. Natl. Acad. Sci. U.S.A. 91, 7833. Gabay, C. et al. (1996) Clin. Exp. Immunol. 105, 260. Lass, A. et al. (2001) Fertil. Steril. 76, 1091. Robb, L. et al. (2002) J. Reprod. Immunol. 57, 129. Ledee Bataille, N. et al. (2002) Hum. Reprod. 17, 213. Vos, J.P. et al. (1996) Perspect. Dev. Neurobiol. 4, 39. Butzkueven, H. et al. (2002) Nat. Med. 8, 613. Horton, A.R. et al. (1996) Perspect. Dev. Neurobiol. 4, 35. Murphy, M. et al. (1997) Prog. Neurobiol. 52, 355. Rajan, P. et al. (1995) Neuroreport 6, 2240. Akita, S. et al. (1996) J. Clin. Endocrinol. Metab. 81, 4170. Bamber, B.A. et al. (1994) Proc. Natl. Acad. Sci. U.S.A. 91, 7839. Ludlam, W.H. et al. (1994) Dev. Biol. 164, 528. Curtis, R. et al. (1994) Neuron 12, 191. Mayer, M. et al. (1994) Development 120, 143.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300069-1	L-200_0.1 mg	0.1 mg	$595		Add to Cart
BHP21300069-2	L-200_0.25 mg	0.25 mg	$1071		Add to Cart
BHP21300069-3	L-200_0.5 mg	0.5 mg	$1937		Add to Cart
BHP21300069-4	L-200_1 mg	1 mg	$2959		Add to Cart
BHP21300069-5	L-200_10 mcg	10 mcg	$85		Add to Cart
BHP21300069-6	L-200_5 mcg	5 mcg	$66		Add to Cart
BHP21300069-7	L-200_50 mcg	50 mcg	$333		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.