JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Recombinant human GDNF protein

SKU : BHP21300046

Human Glial-Derived Neurotrophic Factor, Recombinant, E. coli

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	G-240, G-240_0.1 mg, G-240_0.25 mg, G-240_0.5 mg, G-240_1 mg, G-240_10 mcg, G-240_25 mcg, G-240_5 mcg, G-240_50 mcg
Description	Human Glial-Derived Neurotrophic Factor, Recombinant, E. coli
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeated freeze-thaw cycles may result in loss of activity.
Background	Glial-derived neurotrophic factor (GDNF) is a member of the TGF-beta superfamily. GDNF signals through a multi-component receptor system, composed of a RET proto-oncogene and one of the four alpha1-alpha4 receptors.1GDNF promotes survival of various neuronal cells, including motoneurons,2,3 Purkinje cells and sympathetic neurons.4 In embryonic midbrain cultures, GDNF promotes the survival and morphological differentiation of dopaminergic neurons and increases their high-affinity DA uptake.5 Cells that express GDNF include Sertoli cells, type 1 astrocytes, Schwann cells,6 neurons, pinealocytes, and skeletal muscle cells.7In vivo, following transection of facial motor neuron axons, locally applied GDNF has been shown to rescue virtually all damaged neurons from cell death.8 GDNF may be of clinical relevance in the treatment of Parkinson's disease that is characterized by progressive degeneration of midbrain dopaminergic neurons.9,10
Biological Activity	GDNF enhances survival and differentiation of dopaminergic neurons. It is also a potent survival factor for motor neurons1-3.
Formulation	Lyophilized from filtrated Ammonium acetate solution. May contain acetate as a residual counter ion.
Molecular Weight	30.1 kDa (dimer)
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeat freeze-thawing may result in loss of activity.
Source	Recombinant, E. coli
Accession Number	P39905
Concentration	1 - 10 ng/ml
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: yes Is Toxin: No
UNSPSC Code	12352202
Lead Time	1-2 Business Days

Synonyms	Glial Cell Line-Derived Neurotrophic Factor
Gene Id	GFRA1, RET
Sequence	SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI-OH
Target	GFRA1

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Western blot

Reference	Airaksinen, M.S. Saarma, M. (2002) Nat. Rev. Neurosci. 3, 383. Henderson, C.E. et al. (1994) Science 266, 1062. Houenou, L.J. et al. (1996) Cell. Tissue Res. 286, 219. Kobayashi, M. and Matsuoka, I. (2000) Neuroreport 11, 2541. Tomac, A. et al. (1995) Nature 373, 335. Zhou, F.Q. et al. (2003) Cell 113, 814. Lin, L.F. et al. (1993) Science 260, 1130. Matheson, C.R. et al. (1997) Neuroreport 8, 1739. Brundin, P. (2002) Brain 125, 2149. Grondin, R. and Gash, D.M. (1998) J. Neurol. 245, P35. Lin, L.F. et al. (1993) Science 260, 1130. Lin, L.F. et al. (1994) J. Neurochem. 63, 758. Henderson, C.E. et al. (1995) Science 266, 1062.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300046-1	G-240_0.1 mg	0.1 mg	$670		Add to Cart
BHP21300046-2	G-240_0.25 mg	0.25 mg	$1490		Add to Cart
BHP21300046-3	G-240_0.5 mg	0.5 mg	$2682		Add to Cart
BHP21300046-4	G-240_1 mg	1 mg	$3797		Add to Cart
BHP21300046-5	G-240_10 mcg	10 mcg	$92		Add to Cart
BHP21300046-6	G-240_25 mcg	25 mcg	$210		Add to Cart
BHP21300046-7	G-240_5 mcg	5 mcg	$76		Add to Cart
BHP21300046-8	G-240_50 mcg	50 mcg	$375		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.