JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Recombinant human FGF-b protein

SKU : BHP21300042

Human Fibroblast Growth Factor-basic, Recombinant, E. coli

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	F-170, F-170_0.1 mg, F-170_0.25 mg, F-170_0.5 mg, F-170_1 mg, F-170_10 mcg, F-170_25 mcg, F-170_50 mcg
Description	Human Fibroblast Growth Factor-basic, Recombinant, E. coli
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeated freeze-thaw cycles may result in loss of activity.
Background	Fibroblast growth factor-basic (FGF-b, FGF-2) belongs to the 23 member FGF family.1 FGFs play major roles in development,2 wound healing,3 hematopoiesis,4 tumorigenesis,5 and angiogenesis.6 It is expressed mostly in tissues of mesoderm and neuroectoderm origin.7FGF-basic exists in four molecular forms, three high molecular weight (21.5, 22, and 24 kDa), and one 18 kDa forM8 The higher molecular weight forms are mainly nucleus associated. The 18 kDa form, which lacks a signal sequence, is cytoplasmic or found at the cell surface.9FGF-basic may be released from damaged cells or could be released by an exocytotic mechanism that is independent of the ER-Golgi pathway.10 Secreted FGF interacts with specific cell surface receptors. The FGF receptor family consists of four members: FGFR-1 (flg), FGFR-2 (bek, KGFR), FGFR-3 and FGFR-4. These receptors comprise a conserved tyrosine kinase domain, a transmembrane domain and an extracellular ligand binding domain.11 Binding of FGF-basic to its receptor is regulated by heparan sulfate proteoglycans.12FGF-basic is implicated in many biological processes. It has been shown to induce endothelial cell proliferation, migration and angiogenesis in vitro and in vivo,13 stimulate myeloid progenitors,14 stimulate stromal growth,15 promote the release of endothelium from its connective tissue anchor (thus encouraging the entry of new vascular endothelium),6 regulate oligodendrocyte progenitor proliferation and differentiation in culture,16 and play a role in the autonomous growth of melanoma cells.17
Biological Activity	FGF-basic is a heparin binding growth factor which stimulates the proliferation of a wide variety of cells, including mesenchymal, neuroectodermal, endothelial, and smooth muscle cells, among many others. FGF-basic also induces neuronal and glial differentiation, survival and regeneration1-4.
Formulation	Lyophilized from filtrated Ammonium acetate solution. May contain acetate as a residual counter ion.
Molecular Weight	16.5 kDa
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeat freeze-thawing may result in loss of activity.
Source	Recombinant, E. coli
Accession Number	P09038
Concentration	EC50 = ~17 pM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: yes Is Toxin: No
UNSPSC Code	12352202
Lead Time	1-2 Business Days

Synonyms	Heparin-Binding Growth Factor 2, Basic Fibroblast Growth Factor
Gene Id	FGF2, FGFR1, FGFR2, FGFR3, FGFR4, CSPG4, FGFBP1, TEC, FGFBP3, ITGAV, ITGB3
Sequence	MPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Target	FGF receptors

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Cell proliferation assay

Reference	Fernig, D.G. and Gallagher, J.T. (1994) Prog. Growth Factor Res. 5, 353. Oda, Y. et al. (2004) J. Oral Maxillofac. Surg. 62, 73. Yetgin, S. et al. (2001) Leuk. Lymphoma 42, 83. Strutz, F. et al. (2002) Kidney Int. 61, 1714. Slavin, J. (1995) Cell Biol. Int. 19, 431. Bikfalvi, A. et al. (1997) Angiogenesis 1, 155. Bruno, E. et al. (1991) Blood 77, 2339. Huang, S. and Terstappen, L.W. (1992) Nature 360, 745. Bansal, R. and Pfeiffer, S.E. (1997) J. Neurosci. Res. 50, 215. Halaban, R. (1996) Semin. Oncol. 23, 673. Florkiewicz, R.Z. and Sommer. A. (1989) Proc. Nat. Acad. Sci. U.S.A. 86, 3978. Allouche, M. (1995) Leukemia 9, 937. Mignatti, P. et al. (1992) J. Cell Physiol. 151, 81. Jaye, M. et al. (1992) Biochim. Biophys. Acta. 1135, 185. Ornitz, D.M. (2000) BioEssays 22, 108. Bikfalvi, A. et al. (1997) Endocr. Rev. 18, 26. Ornitz, D.M. and Itoh, N. (2001) Genome Biol. 2, 3005.1. Morrison, R.S. et al. (1986) Proc. Natl. Acad. Sci. U.S.A. 83, 7537. Walicke, P. et al. (1986) Proc. Natl. Acad. Sci. U.S.A. 83, 3012. Grinspan, J.B. et al. (1993) J. Neurosci. Res. 36, 672. Burgess, W.H. and Macig, T. (1989) Ann. Rev. Biochem. 58, 575.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300042-1	F-170_0.1 mg	0.1 ml	$297		Add to Cart
BHP21300042-2	F-170_0.25 mg	0.25 mg	$665		Add to Cart
BHP21300042-3	F-170_0.5 mg	0.5 mg	$824		Add to Cart
BHP21300042-4	F-170_1 mg	1 mg	$1227		Add to Cart
BHP21300042-5	F-170_10 mcg	10 mcg	$76		Add to Cart
BHP21300042-6	F-170_25 mcg	25 mcg	$147		Add to Cart
BHP21300042-7	F-170_50 mcg	50 mcg	$192		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.