JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Recombinant human CNTF protein

SKU : BHP21300027

Human Ciliary Neurotrophic Factor, Recombinant, E. coli

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	C-240, C-240_0.1 mg, C-240_0.25 mg, C-240_0.5 mg, C-240_1 mg, C-240_10 mcg, C-240_2.5 mg, C-240_25 mcg, C-240_50 mcg
Description	Human Ciliary Neurotrophic Factor, Recombinant, E. coli
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeated freeze-thaw cycles may result in loss of activity.
Background	CNTF is a polypeptide trophic factor, a member of the alpha-helical cytokine superfamily1. It was initially purified from the chick eye on the basis of its ability to promote survival of E8 chick ciliary ganglion neurons in culture2. CNTF is synthesized by glia both in the CNS and PNS3 and it has been shown to be ubiquitously distributed in neurons and glia throughout the rodent brain4. CNTF effects are mediated by a tripartite receptor complex consisting of two signal-transducing subunits (leukemia inhibitory factor receptor, gp130) and a CNTF-specific ligand-binding-subunit (CNTFR)5.CNTF can support the survival of many different cell populations within the PNS and CNS6. In vitro, CNTF promotes proliferation and neuronal specifications in hippocampal neurons. In vivo, it supports the viability of non-primate motor neurons7, induces sprouting of cholinergic motor neurons8 and delays neural degeneration in genetic models of motor neuron disease9. In addition, it is involved in the development stage of astrocytes and oligodendocytes10.
Biological Activity	CNTF is a potent neurotrophic factor that was originally characterized as a survival factor for chick ciliary neurons. CNTF supports growth and survival of DRG, motor and sympathetic neurons1-4.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	22.9 kDa
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeat freeze-thawing may result in loss of activity.
Source	Recombinant, E. coli
Accession Number	P26441
Concentration	EC50 = 1 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: yes Is Toxin: No
UNSPSC Code	12352202
Lead Time	1-2 Business Days

Synonyms	Ciliary Neurotrophic Factor
Gene Id	IL6ST, CNTFR, LIFR
Sequence	MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
Target	leukemia inhibitory factor receptor, gp130, CNTFR

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Western blot

Reference	Mufson, E.J. et al. (1999) Prog. Neurobiol. 57, 451. Adler, R. et al. (1979) Science 204, 1434. Murphy, M. et al. (1997) Prog. Neurobiol. 52, 355. Henderson, J.T. et al. (1994) Mol. Brain Res. 22, 151. Stahl, N. et al. (1993) J. Biol. Chem. 268, 7628. Richardson, P.M. (1994) Pharmacol. Ther. 63, 187. Ip, N.Y. et al. (1991) J. Physiol. 85, 123. Gurney, M.E. et al. (1992) J. Neurosci. 12, 3241. Sendtner, M. et al. (1992) Nature 358, 502. Mayer, M. et al. (1994) Development 120, 143. Sendtner, M. et al. (1990) Nature 345, 440. Barbin, G. et al. (1984) J. Neurochem. 43, 1468. Manthorpe, M. et al. (1986) Brain Res. 367, 282. Kotzbauer, P.T. et al. (1994) Neuron 12, 763.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300027-1	C-240_0.1 mg	0.1 mg	$460		Add to Cart
BHP21300027-2	C-240_0.25 mg	0.25 mg	$912		Add to Cart
BHP21300027-3	C-240_0.5 mg	0.5 mg	$1459		Add to Cart
BHP21300027-4	C-240_1 mg	1 mg	$2337		Add to Cart
BHP21300027-5	C-240_10 mcg	10 mcg	$92		Add to Cart
BHP21300027-6	C-240_2.5 mg	2.5 mg	$4575		Add to Cart
BHP21300027-7	C-240_25 mcg	25 mcg	$182		Add to Cart
BHP21300027-8	C-240_50 mcg	50 mcg	$286		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.