JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Recombinant human BDNF protein

SKU : BHP21300012

Human Brain-Derived Neurotrophic Factor, Recombinant, E. coli

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	B-250, B-250_0.1 mg, B-250_0.25 mg, B-250_0.5 mg, B-250_1 mcg, B-250_1 mg, B-250_10 mcg, B-250_25 mcg, B-250_5 mcg, B-250_50 mcg
Description	Human Brain-Derived Neurotrophic Factor, Recombinant, E. coli
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeated freeze-thaw cycles may result in loss of activity.
Background	Brain-derived neurotrophic factor (BDNF) is a member of the NGF family of neurotrophic growth factors, and shares high sequence homology with NGF, NT-3 and NT-4/5.1,2 BDNF is found in neurons of the central nervous systeM It is expressed predominantly in hippocampus, cortex, and amygdaloid complex.3The synthesis of BDNF is subject to regulation by neuronal activity and specific transmitter systems.4BDNF binds to p75NTR, the neurotrophin receptor, and may initiate programmed cell death by acting through this receptor.5 Signal transduction is activated by the dimerization and autophosphorylation of the TrkB receptor.6BDNF supports the survival of primary sensory neurons,7 retinal ganglion cells, basal forebrain cholinergic neurons,8 and mesencephalic dopaminergic neurons in vitro.9 BDNF prevents death of cultured rat spinal motor neurons,10 and rescues substantial numbers of motor neurons after lesioning of the neonatal sciatic or facial nerve.11 Expression is switched on in Schwann cells following peripheral nerve lesion.11 BDNF also inhibits the normal cell death of embryonic chick motor neurons.12BDNF acts in concert with other factors and neurotrophins. The biological activities of BDNF and NT-3 (neurotrophin-3) are additive, and BDNF also interacts with LIF.13The effects of BDNF on motor neurons raise the possibility that it may be useful in treating patients with motor neuropathies and Amyotrophic Lateral Sclerosis (ALS).14
Biological Activity	BDNF is a neurotrophic factor and binds p75NTR as well as TrkB receptors1,2. BDNF supports the survival of many cell types3-8.
Formulation	Lyophilized from filtrated Ammonium acetate solution. May contain acetate as a residual counter ion.
Molecular Weight	27 kDa (dimer)
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeat freeze-thawing may result in loss of activity.
Source	Recombinant, E. coli
Accession Number	P23560
Concentration	ED50 = 220 pM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: yes Is Toxin: No
UNSPSC Code	12352202
Lead Time	1-2 Business Days

Synonyms	Brain-Derived Neurotrophic Factor
Gene Id	NGFR,NTRK2
Sequence	HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR-OH
Target	p75NTR, TrkB receptors

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Western blot

Reference	Robinson, R.C. et al. (1995) Biochemistry 34, 4139. Ibanez, C.F. (1998) Trends Neurosci. 21, 438. Wetmore, C. et al. (1990) Exp. Neurol. 109, 141. Thoenen, H. et al. (1991) Ann. N. Y. Acad. Sci. 640, 86. Tolkovsky, A. (1997) Trends Neurosci. 20, 1. Jing, S. et al. (1992) Neuron 9, 1067. Acheson, A. et al. (1995) Nature 374, 450. Morse, J.K. et al. (1993) J. Neurosci. 13, 4146. Hyman, C. et al. (1991) Nature 350, 230. Friedman, B. et al. (1995) J. Neurosci. 15, 1044. Meyer, M. et al. (1992) J. Cell Biol. 119, 45. Koliatsos, V.E. et al. (1993) Neuron 10, 359. Rodriguez-Tebar, A. et al. (1992) EMBO J. 11, 917. Chun, H.S. et al. (2000) Neuroreport 11, 511. Tolkovsky, A. (1997) Trends Neurosci. 20, 1. Jing, S. et al. (1992) Neuron 9, 1067. Acheson, A. et al. (1995) Nature 374, 450. Morse, J.K. et al. (1993) J. Neurosci. 13, 4146. Hyman, C. et al. (1991) Nature 350, 230. Friedman, B. et al. (1995) J. Neurosci. 15, 1044. Meyer, M. et al. (1992) J. Cell Biol. 119, 45. Koliatsos, V.E. et al. (1993) Neuron 10, 359.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300012-1	B-250_0.1 mg	0.1 mg	$1453		Add to Cart
BHP21300012-2	B-250_0.25 mg	0.25 mg	$2959		Add to Cart
BHP21300012-3	B-250_0.5 mg	0.5 mg	$4721		Add to Cart
BHP21300012-4	B-250_1 mcg	1 mcg	$76		Add to Cart
BHP21300012-5	B-250_1 mg	1 mg	$7573		Add to Cart
BHP21300012-6	B-250_10 mcg	10 mcg	$229		Add to Cart
BHP21300012-7	B-250_25 mcg	25 mcg	$509		Add to Cart
BHP21300012-8	B-250_5 mcg	5 mcg	$210		Add to Cart
BHP21300012-9	B-250_50 mcg	50 mcg	$912		Add to Cart
BHP21300012-10	B-250_1 mcg	5x1 mcg	$287		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.