JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Recombinant human BDNF proDomain protein

SKU : BHP21300011

Human Brain-Derived Neurotrophic Factor proDomain, Recombinant, E. coli

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	B-245, B-245_0.1 mg, B-245_0.5 mg, B-245_10 mcg, B-245_25 mcg, B-245_50 mcg
Description	Human Brain-Derived Neurotrophic Factor proDomain, Recombinant, E. coli
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. Repeated freeze-thaw cycles may result in loss of activity.
Background	BDNF regulates neuronal survival, differentiation, and synaptic plasticity. It affects the release of excitatory neurotransmitters and has been found to affect cardiovascular development and function.1 Like many other neurotrophins, BDNF is a cleavage product of the BDNF precursor, proBDNF. This precursor may be cleaved by various proteases, intracellularly by furin and extracellularly by several proteases including prohormone convertases, plasminogen activator, MMP-3 and MMP-7 in vitro.2,3Two different trans-membrane receptor proteins mediate BDNF and proBDNF signal transduction: the TrkB, and the pan-neurotrophic receptor p75NTR.4 ProBDNF has been demonstrated to induce TrkB phosphorylation in vitro and to bind p75NTR and sortilin to promote apoptosis.5,6In many cases, the full prodomain region derived from the protein precursor has biological functions, for instance; the prodomain of the transforming growth factor beta (TGFbeta) affects the dimerization and folding as well as the activity of the mature proteins via non-covalent association. The propeptide of the bone morphogenetic proteins BMP-4 and BMP-7 regulates the diffusion and distribution of these growth factors within the extracellular matrix.7,8 The prodomain region of the BDNF precursor plays an important role in regulating its intracellular trafficking to secretory pathways.9 However, the role of the full BDNF-prodomain, which is a product of proteolytic cleavage of proBDNF, is not clearly understood. Furthermore, binding competition studies suggest that binding sites for BDNF prodomain are located in the tunnel of the ten-bladed b-propeller domain of sortilin.10
Biological Activity	BDNF is a neurotrophic factor and binds p75NTR as well as TrkB receptors1,2. BDNF supports the survival of many cell types3-8. proBDNF has been shown to be a pro-apoptotic ligand for sympathetic neurons9 expressing both p75 and sortilin, and to be involved in LTD10.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	12.4 kDa
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. Repeat freeze-thawing may result in loss of activity.
Source	Recombinant, E. coli
Concentration	10 - 100 ng/ml
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: yes Is Toxin: no
UNSPSC Code	12352202
Lead Time	1-2 Business Days

Gene Id	NGFR,NTRK2,SORT1,SORCS2
Sequence	MAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRR-OH

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Western blot

Reference	Segal, R. (2001) Sci. STKE. 2001, pe1. Hariri, A.R. et al. (2003) J. Neurosci. 23, 6690. Fahnestock, M. et al. (2001) Mol. Cell. Neurosci. 18, 210. Dechant, G. et al. (1993) Development 119, 545. Mowla, S.J. et al. (2001) J. Biol. Chem. 276, 12660. Teng, H.K. et al. (2005) J. Neurosci. 25, 5455. Gray, A.M. and Mason, A.J. (1990) Science 247, 1328. Gregory, K.E. et al. (2005) J. Biol. Chem. 280, 27970. Egan, M. et al. (2003) Cell 112, 257. Quistgaard, E.M. et al. (2008) Nat. Struct. Mol. Biol. 16, 96. Tolkovsky, A. (1997) Trends Neurosci. 20, 1. Jing, S. et al. (1992) Neuron 9, 1067. Acheson, A. et al. (1995) Nature 374, 450. Morse, J.K. et al. (1993) J. Neurosci. 13, 4146. Hyman, C. et al. (1991) Nature 350, 230. Friedman, B. et al. (1995) J. Neurosci. 15, 1044. Meyer, M. et al. (1992) J. Cell Biol. 119, 45. Koliatsos, V.E. et al. (1993) Neuron 10, 359. Teng, H.K. et al. (2005) J. Neurosci. 25, 5455. Woo, N.H. et al. (2005) Nat. Neurosci. 8, 1069.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300011-1	B-245_0.1 mg	0.1 mg	$808		Add to Cart
BHP21300011-2	B-245_0.5 mg	0.5 mg	$2858		Add to Cart
BHP21300011-3	B-245_10 mcg	10 mcg	$235		Add to Cart
BHP21300011-4	B-245_25 mcg	25 mcg	$406		Add to Cart
BHP21300011-5	B-245_50 mcg	50 mcg	$577		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.