JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Recombinant human Artemin protein

SKU : BHP21300097

Human Artemin, Recombinant, E. coli

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	RPA-100, RPA-100_0.1 mg, RPA-100_0.25 mg, RPA-100_0.5 mg, RPA-100_1 mg, RPA-100_10 mcg, RPA-100_25 mcg, RPA-100_5 mcg
Description	Human Artemin, Recombinant, E. coli
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. Repeated freeze-thaw cycles may result in loss of activity.
Background	Artemin (ART), also named enovin and neublastin, is a neurotrophic factor that is crucial for the proper development of the sympathetic nervous systeM ART belongs to the glial cell line-derived neurotrophic factor (GDNF) family of ligands, which also includes GDNF, neurturin (NRTN), and persephin (PSPN). Artemin mRNA is expressed in many human adult and fetal tissues and in rat Schwann cells. Artemin's activity is mediated by a receptor complex composed of a receptor tyrosine kinase signaling component, RET, which is common for all GFLs, and a specific anchored membrane protein, GFRalpha3. Experimental studies have suggested that artemin supports the survival of cultured neurons from the dorsal root, trigeminal, nodose, and superior cervical ganglia and that it affects neurite outgrowth from the dorsal root and sympathetic ganglia of murine embryos. Recent investigations have reported that systemic artemin prevents and reverses neuropathic pain1.
Biological Activity	Artemin supports the survival of different peripheral neurons and dopaminergic midbrain neurons both in vitro and in vivo. In addition, it supports motor neurons in culture1-3.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	23.9 kDa (dimer)
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. Repeat freeze-thawing may result in loss of activity.
Source	Recombinant, E. coli
Accession Number	Q5T4W7
Concentration	0.1 - 10 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: yes Is Toxin: No
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Inter-chain disulfide bonds between Cys16-Cys81, Cys43-Cys109, Cys47-Cys111 and intra-chain disulfide bond between Cys80 of two hArtemin molecules.

Synonyms	Enovin, Neublastin
Gene Id	GFRA3
Sequence	AGGPGSRARAAGARGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG
Target	GFRa3

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Western blot

Reference	Lucini, C. et al. (2004) Anat. Embryol. 208, 403. Kotzbauer, P.T. et al. (1996) Nature 384, 467. Milbrandt, J. et al. (1998) Neuron 20, 245. Baloh, R.H. et al. (1998) Neuron 21, 1291.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300097-1	RPA-100_0.1 mg	0.1 mg	$832		Add to Cart
BHP21300097-2	RPA-100_0.25 mg	0.25 mg	$1529		Add to Cart
BHP21300097-3	RPA-100_0.5 mg	0.5 mg	$2484		Add to Cart
BHP21300097-4	RPA-100_1 mg	1 mg	$4406		Add to Cart
BHP21300097-5	RPA-100_10 mcg	10 mcg	$117		Add to Cart
BHP21300097-6	RPA-100_25 mcg	25 mcg	$272		Add to Cart
BHP21300097-7	RPA-100_5 mcg	5 mcg	$85		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.