JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Pterinotoxin-2

SKU : BHP21300290

A Blocker of NaV1.3 and NaV1.7 Na+ Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STT-150, STT-150_0.1 mg, STT-150_0.5 mg, STT-150_1 mg, STT-150_10 mg, STT-150_5 mg, STT-150_50 mcg
Description	A Blocker of NaV1.3 and NaV1.7 Na+ Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C156H237N45O42S7
Background	Pterinotoxin-2 is isolated from the Pterinochilus murinus (Usambara) spider venom and is a synthetic version of the peptide1.Pterinotoxin-2 inhibits voltage-gated rat NaV1.3 and NaV1.7 Na+ channels.Voltage-gated sodium channels (VGSC, NaV) play a critical role in excitability of nociceptors (pain-sensing neurons). The peripheral-specific sodium channels NaV1.7, NaV1.8 and NaV1.9 are particularly important in the pathophysiology of different pain syndromes and hence, thought to be potential targets for pain therapeutics2,3.The expression and functional properties of NaV channels in peripheral sensory neurons can be dynamically regulated following axonal injury or peripheral inflammation4.Pterinotoxin-2 shows high homology to ProTx-II (#STP-100) (75%), Phrixotoxin-2 (#STP-710) (76%) and Phrixotoxin-1 (#STP-700) (70%).
Biological Activity	Pterinotoxin-2 inhibits voltage-gated Na+ NaV1.3 and NaV1.7 channels1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	3639.3 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	B3EWN1
Concentration	0.5 - 1 uM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys2-Cys16, Cys9-Cys21, Cys15-Cys25 Leu29 - C-terminal amidation
Origin	Pterinochilus murinus (Mombasa golden starburst baboon spider)

Synonyms	beta/kappa-Theraphotoxin-Pm2a, beta/kappa-TRTX-Pm2a, Beta/kappa-theraphotoxin-Pmu2a
Gene Id	SCN3A,SCN9A
Sequence	YCQEFLWTCDEERKCCGDMVCRLWCKKRL-NH2
Target	NaV1.3, NaV1.7 Na+ channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Meir, A. et al. (2011). Novel peptides isolated from spider venom, and uses thereof. U.S. Patent Application Publication # US 2011/0065647 A1. Sheets, P.L. et al. (2008) J. Pharmacol. Exp. Ther. 326, 89. Zimmermann, K. et al. (2007) Nature 447, 855. Amir, E. et al. (2006) J. Pain 7, S1. Meir, A. et al. (2011). Novel peptides isolated from spider venom, and uses thereof. U.S. Patent Application Publication # US 2011/0065647 A1.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300290-1	STT-150_0.1 mg	0.1 ml	$406		Add to Cart
BHP21300290-2	STT-150_0.5 mg	0.5 mg	$1217		Add to Cart
BHP21300290-3	STT-150_1 mg	1 mg	$1659		Add to Cart
BHP21300290-4	STT-150_10 mg	10 mg	$7042		Add to Cart
BHP21300290-5	STT-150_5 mg	5 mg	$4967		Add to Cart
BHP21300290-6	STT-150_50 mcg	50 mcg	$287		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.