JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

ProTx-II

SKU : BHP21300262

A Blocker of NaV1.7 and NaV1.5 Channels and Some T-Type Ca2+ Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STP-100, STP-100_0.1 mg, STP-100_0.25 mg, STP-100_0.5 mg, STP-100_1 mg, STP-100_10 mg, STP-100_5 mg
Description	A Blocker of NaV1.7 and NaV1.5 Channels and Some T-Type Ca2+ Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C168H250N46O41S8
Background	ProTx-II is a peptidyl toxin originally produced in Thrixopelma pruriens, the Peruvian green velvet tarantula. It was identified as a voltage-gated Na+ channel (NaV) blocker which inhibits both tetrodotoxin-sensitive and tetrodotoxin-resistant channels1.Binding of ProTx-II to an extracellular domain of NaV channel, probably to a hydrophobic site3, inhibits current by shifting the channel activation to more positive potentials1-2.ProTx-II Inhibits NaV1.2, NaV1.3, NaV1.5, NaV1.6, NaV1.7, and NaV1.8. It is a significantly more potent inhibitor against NaV1.7 than the other NaV channel subtypes1.ProTx-II was also found as an effective modulator which shifts the voltage dependence activity of T-type Ca2+ channel1.
Biological Activity	ProTx-II inhibits NaV channels1. ProTx-II could also modulate T-type Ca2+ channels at higher concentrations2.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	3826.6 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P83476
Concentration	10 - 500 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
Cas Number	484598-36-9
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys2-Cys16, Cys9-Cys21, and Cys15-Cys25
Origin	Thrixopelma pruriens (Peruvian green velvet tarantula)

Synonyms	beta/omega-Theraphotoxin-Tp2a, Protoxin-2, PT-II, ProTx2, Protoxin2, ProTx II
Gene Id	CACNA1C,CACNA1H,SCN2A,SCN3A,SCN4A,SCN5A,SCN8A,SCN9A,SCN10A
Sequence	YCQKWMWTCDSERKCCEGMVCRLWCKKKLW-OH
Target	NaV channels and T-type Ca2+ channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Middleton, R.E. et al. (2002) Biochemistry 41, 14734. Smith, J.J. et al. (2005) J. Biol. Chem. 280, 11127. Smith, J.J. et al. (2007) J. Biol. Chem. 282, 12687. Middleton, R.E. et al. (2002) Biochemistry 41, 14734. Hall, E.O. et al. (2010) FASEB J. 24, 608.14.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300262-1	STP-100_0.1 mg	0.1 mg	$130		Add to Cart
BHP21300262-2	STP-100_0.25 mg	0.25 mg	$273		Add to Cart
BHP21300262-3	STP-100_0.5 mg	0.5 mg	$437		Add to Cart
BHP21300262-4	STP-100_1 mg	1 mg	$699		Add to Cart
BHP21300262-5	STP-100_10 mg	10 mg	$4468		Add to Cart
BHP21300262-6	STP-100_5 mg	5 mg	$2792		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.