JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Phrixotoxin-3

SKU : BHP21300273

A Potent Blocker of NaV1.2 and NaV1.6 Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STP-720, STP-720_0.1 mg, STP-720_0.25 mg, STP-720_0.5 mg, STP-720_1 mg, STP-720_10 mg, STP-720_5 mg
Description	A Potent Blocker of NaV1.2 and NaV1.6 Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C176H270N52O47S6
Background	Phrixotoxin-3 is a peptidyl toxin originally isolated from the venom of Phrixotrichus auratus tarantula. This toxin is a highly specific and potent blocker of voltage-gated Na+ channels especially the neuronal channel NaV1.2 with properties similar to those of typical gating-modifier toxins. It causes a depolarizing shift in the gating kinetics by blocking the inward component of the sodium current1.Injection of Phrixotoxin-3 to mice causes neurotoxicity symptoms that are expressed by general ataxia, lack of response to stimuli, and semiparalysis1.
Biological Activity	Phrixotoxin-3 specifically and reversibly blocks NaV1.21.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	4058.8 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P84510
Concentration	0.5 - 300 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
Cas Number	880886-00-0
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys2-Cys17, Cys9-Cys23, and Cys16-Cys30 Ile34 - C-terminal amidation
Origin	Paraphysa scrofa (Chilean copper tarantula) (Phrixotrichus auratus)

Synonyms	PaurTx3, beta-TRTX-Ps1a, beta-theraphotoxin-Ps1a, Phrixotoxin 3
Gene Id	SCN1A, SCN2A,SCN4A,SCN5A,SCN8A,SCN9A,SCN10A
Sequence	DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI-NH2
Target	NaV1.2, NaV1.6 channels

Country Of Origin	Israel/IL
Purity	>=99% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Bosmans, F. et al. (2006) Mol. Pharmacol. 69, 419. Bosmans, F. et al. (2006) Mol. Pharmacol. 69, 419.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300273-1	STP-720_0.1 mg	0.1 mg	$185		Add to Cart
BHP21300273-2	STP-720_0.25 mg	0.25 mg	$384		Add to Cart
BHP21300273-3	STP-720_0.5 mg	0.5 mg	$613		Add to Cart
BHP21300273-4	STP-720_1 mg	1 mg	$985		Add to Cart
BHP21300273-5	STP-720_10 mg	10 mg	$5515		Add to Cart
BHP21300273-6	STP-720_5 mg	5 mg	$3446		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.