JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Phrixotoxin-1

SKU : BHP21300271

A Potent Blocker of KV4.2 and KV4.3 Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STP-700, STP-700_0.1 mg, STP-700_0.5 mg, STP-700_1 mg, STP-700_10 mg, STP-700_5 mg, STP-700_50 mcg
Description	A Potent Blocker of KV4.2 and KV4.3 Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C156H240N44O37S7.
Background	Phrixotoxin-1 (PaTx1) is a 29 amino acid peptidyl toxin isolated from the venom of the theraphosid Phrixotrichus auratus, which potently blocks A-type K+ currents.PaTx1 specifically blocks KV4.3 and KV4.2 currents with a 5 nM < IC50 < 70 nM, by modifying the gating properties of these channels.1As with other spider toxins, PaTx1 presents an active molecular surface, including a hydrophobic patch surrounded by charged residues, which are important for their binding on KV channels. Electrophysiological studies show that the PaTx1 blocks KV4 channels via a mechanism similar to that of hanatoxins on KV2 channels, as they bind and stabilize the preferentially closed state of the channel, in a voltage-dependent manner.2PaTx1 is a crucial tool for understanding the contribution of KV4.3 and KV4.2 in cardiac electrogenesis. Treatment of mice with PaTx1 results in numerous transient cardiac adverse reactions including the occurrence of premature ventricular beats, ventricular tachycardia, different degrees of atrioventricular (AV) blockage and prolongation of the QT interval.1
Biological Activity	Phrixotoxin-1 specifically and reversibly blocks KV4.2 and KV4.3 channels1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	3548.4 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P61230
Concentration	10 - 100 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
Cas Number	221872-97-5
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys2-Cys16, Cys9-Cys21, and Cys15-Cys25 Ile29 - C-terminal amidation
Origin	Paraphysa scrofa (Chilean copper tarantula) (Phrixotrichus auratus)

Synonyms	kappa-theraphotoxin-Ps1a, kappa-TRTX-Ps1a, PaTX1
Gene Id	KCND2,KCND3,SCN9A
Sequence	YCQKWMWTCDSARKCCEGLVCRLWCKKII-NH2
Target	KV4.2, KV4.3 channels

Country Of Origin	Israel/IL
Purity	>=99% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Chagot, B. et al. (2004) Protein Sci. 13, 1197. Diochot, S. et al. (1999) Br. J. Pharmacol. 126, 251. Chagot, B. et al. (2004) Protein Sci. 13, 1197.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300271-1	STP-700_0.1 mg	0.1 mg	$235		Add to Cart
BHP21300271-2	STP-700_0.5 mg	0.5 mg	$747		Add to Cart
BHP21300271-3	STP-700_1 mg	1 mg	$1153		Add to Cart
BHP21300271-4	STP-700_10 mg	10 mg	$4705		Add to Cart
BHP21300271-5	STP-700_5 mg	5 mg	$3362		Add to Cart
BHP21300271-6	STP-700_50 mcg	50 mcg	$151		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.