JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Phlotoxin 1

SKU : BHP21300274

Selective Blocker of NaV1.7

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STP-800, STP-800_0.1 mg, STP-800_0.25 mg, STP-800_0.5 mg, STP-800_1 mg, STP-800_10 mg, STP-800_5 mg, STP-800_50 mcg
Description	Selective Blocker of NaV1.7
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C183H255N47O47S6
Background	Phlotoxin 1 (PhlTx1) is a voltage-gated Na+ channel (NaV) blocker, originally isolated from the venom of a Phlogiellus genus spider endemic to Papua New Guinea.Phlotoxin 1, characterized by a 34-amino acids sequence with 3 disulfide bridges and structure around the inhibitory cysteine-knot (ICK) architectural motif, was shown to belong to the spider toxin NaSpTx family 11,2.Nav1.7 was identified as the most sensitive ion channel and main target for Phlotoxin 1 inhibition3. NaV1.7 channel plays an important role in human pain signaling pathway and it is an important therapeutic target for treatment of chronic pain. Hence, Phlotoxin 1 is an important candidate for the study of pain, pain treatment, and development of analgesics. It is also an interesting toxin in order to decipher the involvement of Nav1.7 in cellular excitability and pain3,4.
Biological Activity	A potent blocker of Nav1.7 channel1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	4057.7 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P0DM14
Concentration	0.2 - 1 uM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29 Phe34 - C-terminal amidation
Origin	Phlogiellus sp. (Tarantula)

Synonyms	Mu-theraphotoxin-Pspp1, Mu-TRTX-Pspp1, PhlTx1
Gene Id	SCN1A,SCN2A,SCN3A,SCN4A,SCN5A,SCN8A,SCN9A
Sequence	ACLGQWDSCDPKASKCCPNYACEWKYPWCRYKLF-NH2
Target	NaV channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Gonçalves, T.C. et al. (2019) Toxins 11, 484. Cardoso, F.C. and Lewis, R.J. (2019) Front. Pharmacol. 10, 366. Nicolas, S. et al. (2019) Toxins 11, 367. Klint, J.K. et al. (2015) Br. J. Pharmacol. 172, 2445. Nicolas, S. et al. (2019) Toxins 11, 367.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300274-1	STP-800_0.1 mg	0.1 mg	$384		Add to Cart
BHP21300274-2	STP-800_0.25 mg	0.25 mg	$766		Add to Cart
BHP21300274-3	STP-800_0.5 mg	0.5 mg	$1224		Add to Cart
BHP21300274-4	STP-800_1 mg	1 mg	$1959		Add to Cart
BHP21300274-5	STP-800_10 mg	10 mg	$9592		Add to Cart
BHP21300274-6	STP-800_5 mg	5 mg	$6852		Add to Cart
BHP21300274-7	STP-800_50 mcg	50 mcg	$262		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.