JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Phlo1a

SKU : BHP21300266

A Blocker of NaV1.7 Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STP-350, STP-350_0.1 mg, STP-350_0.5 mg, STP-350_1 mg, STP-350_5 mg, STP-350_50 mcg
Description	A Blocker of NaV1.7 Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C178H262N52O49S6
Background	Phlo1a is a voltage-gated NaV1.7 channel blocker. It is a peptide toxin originally isolated from the venom of the Australian Phlogius sp. Tarantula. It inhibits the channel's activation through interaction with one or more voltage-sensor domains. Phlo1a inhibits human NaV1.7 channels in a concentration-dependent manner with an IC50 value of 459 nM1.Phlo1a is 35-residue peptide that belongs to the NaSpTx family and is considered to be a valuable research tool and a lead molecule for the development of ion channel therapeutics. To date, twelve families of NaSpTx have been recognized. Phlo1a belongs to the NaSpTx2 family and contains three disulfide bonds. The majority of tarantula-venom peptides share a highly stable inhibitor cystine knot (ICK) fold that provides resistance to chemical and thermal degradation1.There are nine mammalian subtypes of voltage-gated sodium (NaV) channels: NaV1.1-NaV1.9. They are transmembrane proteins responsible for propagating action potentials in excitable cells, most notably nerves and muscle. These channels are considered to be important therapeutic targets for a wide variety of pathophysiological conditions such as chronic pain, cardiac arrhythmia, and epilepsy1,2.
Biological Activity	PhIo1a is a blocker of NaV1.7 channel1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	4106.8 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P0DL57
Concentration	100 nM - 1 uM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys2-Cys16, Cys9-Cys21, and Cys15-Cys29 (by homology) Ile35 - C-terminal amidation
Origin	Phlogius sp. (Tarantula spider)

Synonyms	Mu-theraphotoxin-Phlo1a, Mu-TRTX-Phlo1a
Gene Id	SCN9A
Sequence	ACRELLGGCSKDSDCCAHLECRKKWPYHCVWDWTI-NH2
Target	NaV1.7 channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Chow, C.Y. et al. (2015) Toxins 7, 2494. Klint J.K. et al. (2015) Br. J. Pharmacol. 172, 2445. Chow, C.Y. et al. (2015) Toxins 7, 2494.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300266-1	STP-350_0.1 mg	0.1 mg	$235		Add to Cart
BHP21300266-2	STP-350_0.5 mg	0.5 mg	$926		Add to Cart
BHP21300266-3	STP-350_1 mg	1 mg	$1302		Add to Cart
BHP21300266-4	STP-350_5 mg	5 mg	$4549		Add to Cart
BHP21300266-5	STP-350_50 mcg	50 mcg	$170		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.