JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Pe1b Toxin

SKU : BHP21300261

Selective potent blocker of Nav1.7 channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STP-050, STP-050_0.1 mg, STP-050_0.5 mg, STP-050_1 mg, STP-050_10 mg, STP-050_5 mg
Description	Selective potent blocker of Nav1.7 channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C175H237N47O49S6
Background	beta/u-theraphotoxin-Pe1b (Pe1b) is a 34 amino acid peptidyl toxin isolated from the venom of the arboreal tarantula Phormingochilus everetti1. Pe1b is a voltage-gated sodium (Nav) channel inhibitor, and it has the greatest inhibitory activity against Nav1.7. Pe1b contains three disulfide bonds that form an inhibitory cysteine-knot (ICK) architectural motif. Its ICK motif belonging to the Nav-targeting spider toxin (NaSpTx) family 2, which contains the most members amongst the 12 sodium channel toxin families (NaSpTx1- NaSpTx12)1,2.Pe1b is highly similar to Protoxin-1 (ProTx-I), which is also an inhibitor of Nav1.7. The C-terminus of both toxins interact with Nav1.71.Nav channels are involved in a wide array of physiological processes. In particular, Nav1.7 plays a critical role in the generation and conduction of action potentials. It is also active in pain sensing nerves. Thus, Pe1b may be an important tool for the study of pain, pain treatment, and the development of analgesics.
Biological Activity	Blocks several voltage-gated sodium channels with most potent activity on Nav1.71.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	3975.5 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P0DQN2
Concentration	50 - 500 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys2-Cys16, Cys9-Cys21, Cys15-Cys28
Origin	Phormingochilus everetti (Malaysian purple earth tiger tarantula)

Synonyms	Beta/mu-theraphotoxin-Pe1b, Beta/mu-TRTX-Pe1b, beta/u-theraphotoxin-Pe1b
Gene Id	SCN2A,SCN8A,SCN9A
Sequence	ECRYWLGGCSKTGDCCEHLSCSPKWHWCVWDGTF-OH
Target	Voltage-gated Na+ channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Rupasinghe, D.B. et al. (2020) Biochem. Pharmacol., 181, 114080. Klint, J.K. et al. (2012) Toxicon, 60, 478.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300261-1	STP-050_0.1 mg	0.1 mg	$576		Add to Cart
BHP21300261-2	STP-050_0.5 mg	0.5 mg	$1495		Add to Cart
BHP21300261-3	STP-050_1 mg	1 mg	$2392		Add to Cart
BHP21300261-4	STP-050_10 mg	10 mg	$13393		Add to Cart
BHP21300261-5	STP-050_5 mg	5 mg	$8371		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.