JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Pandinotoxin Kalpha

SKU : BHP21300270

A Blocker of A-Type and Shaker-Related Voltage-Gated K+ Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STP-500, STP-500_0.1 mg, STP-500_0.5 mg, STP-500_1 mg, STP-500_10 mg, STP-500_5 mg
Description	A Blocker of A-Type and Shaker-Related Voltage-Gated K+ Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C169H267N53O48S7
Background	Scorpion venoms are a rich source of ion channel modulators. The scorpion toxins have been useful molecules in probing the K+ channel structures and functions1.Pandinotoxin Kalpha (PiTx-Kalpha) is a 35 amino acid peptidyl toxin isolated from the Pandinus imperator (Emperor scorpion) venoM It is a highly potent and selective blocker of voltage-activated K+ channels. PiTx-Kalpha preferentially blocks rapidly inactivating (A-type) K+ channels2. In general, channel inhibitors can be pore blockers or gating modifiers. Pore blockers bind to the channel in 1:1 stoichiometry and plug the pore of the channel impeding the flow of the ionic current. These toxins are small proteins that block the passage of K+ ions by binding at the pore entryway on the extracellular side of the channel, thereby inhibiting the ion flux3. The interactions of toxins with K+ channels are among the strongest and most specific known in protein-protein complexes4.
Biological Activity	Pandinotoxin Kalpha is an A-type and Shaker-related K+ channel blocker1-4.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	4033.8 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P55927
Concentration	10 - 200 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
Cas Number	185529-64-0
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys4-Cys25, Cys10-Cys30, Cys14-Cys32
Origin	Pandinus imperator (Emperor scorpion)

Synonyms	Potassium channel toxin alpha-KTx 7.1, Pandinotoxin-alpha, Potassium channel-blocking toxin 2, Pi-2, Pi2, Toxin PiTX-K-alpha, PiTX-Kalpha
Gene Id	KCNA2,KCNA4,KCND1,KCND2,KCND3
Sequence	TISCTNPKQCYPHCKKETGYPNAKCMNRKCKCFGR-OH
Target	A-type and Shaker-related K+ channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Aiyar, J. et al. (1996) J. Biol. Chem. 271, 31013. Tenenholz, T.C. et al. (1997) Biochemistry 36, 2763. Goldstein, S.A. et al. (1994) Neuron 12, 1377. MacKinnon, R. et al. (1988) Neuron 1, 997. Gomez-Lagunas, F. et al. (1996) J. Memb. Biol. 152, 49. Tenenholz, T.C. et al. (1997) Biochemistry 36, 2763. Rogowski, R.S. et al. (1996) Mol. Pharmacol. 50, 1167. Whyment, A.D. et al. (2011) Neuroscience 178, 68.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300270-1	STP-500_0.1 mg	0.1 mg	$325		Add to Cart
BHP21300270-2	STP-500_0.1 mg	5x0.1 mg	$1403		Add to Cart
BHP21300270-3	STP-500_0.5 mg	0.5 mg	$768		Add to Cart
BHP21300270-4	STP-500_1 mg	1 mg	$1227		Add to Cart
BHP21300270-5	STP-500_10 mg	10 mg	$5152		Add to Cart
BHP21300270-6	STP-500_5 mg	5 mg	$3218		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.