JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Osu1 Toxin

SKU : BHP21300244

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STK-010, STK-010_0.1 mg, STK-010_0.5 mg, STK-010_1 mg, STK-010_10 mg, STK-010_5 mg, STK-010_50 mcg
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C332H487N101O83S8
Background	Kappa-lycotoxin-Os1a (Osu1 Toxin) is a 64-amino acid peptidyl toxin derived from the venom of the spider Oculicosa supermirabilis1. Osu1 exhibits inhibitory activity at the hKv1.5 channel and slows the activation kinetics of the Kv1.5 current at ~uM peptide concentration. The mode of action of Osu1 toxin involves binding to the voltage-sensing domain of the hKv1.5 potassium channel rather than occluding its pore. This binding effectively prevents the channel's opening at physiological membrane potentials, resulting in the inhibition of the ultra-rapid delayed rectifier potassium current (IKur). Consequently, this prolongs atrial action potentials, potentially leading to the termination of atrial fibrillation (AF)1,2. The hKv1.5 channel is selectively expressed in human atrial myocytes and is absent in ventricular tissues, reducing the likelihood of ventricular side effects. Osu1 toxin demonstrates a high affinity for hKv1.5, and this specificity makes it a promising candidate for selective AF therapies1,2. The potential applications of Osu1 toxin extend beyond AF. Its unique properties make it a valuable tool for studying ion channel physiology and hold promise for the development of toxin-based therapeutics. Osu1's ability to prolong atrial action potentials without affecting ventricular tissues further highlights its therapeutic relevance1,2.
Biological Activity	Osu1 Toxin acts as the modifier and inhibitor of hKV1.5 ion current1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	7477.7 Da
Source	Synthetic protein
Accession Number	C0HLR8
Concentration	0.3 - 4 uM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys10-Cys26, Cys28-Cys40, Cys17-Cys42, Cys19-Cys56
Origin	Oculicosa supermirabilis (Central Asian wolf-spider)

Synonyms	Kappa-lycotoxin-Os1a, Kappa-LCTX-Os1a, Toxin Osu1
Gene Id	KCNA5
Sequence	RLALPPGAVCNGHKSDCQCFGAKYKCSCPFFWRFRKSAECHCKKGWAWTAIKKRSCHNRYQWSD-OH
Target	Kv1.5 channels

Country Of Origin	Israel/IL
Purity	>= 97% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Alvarado, D. et al. (2021) Front Pharmacol., 11, 563858. Borrego, J. et al. (2021) Pharmaceuticals, 14, 1303.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300244-1	STK-010_0.1 mg	0.1 mg	$615		Add to Cart
BHP21300244-2	STK-010_0.5 mg	0.5 mg	$2034		Add to Cart
BHP21300244-3	STK-010_1 mg	1 mg	$2846		Add to Cart
BHP21300244-4	STK-010_10 mg	10 mg	$7352		Add to Cart
BHP21300244-5	STK-010_5 mg	5 mg	$6125		Add to Cart
BHP21300244-6	STK-010_50 mcg	50 mcg	$388		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.