JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

omega-Agatoxin TK

SKU : BHP21300135

A Blocker of P/Q-Type CaV Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STA-530, STA-530_0.1 mg, STA-530_0.25 mg, STA-530_0.5 mg, STA-530_1 mg, STA-530_50 mcg
Description	A Blocker of P/Q-Type CaV Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C215H337N65O70S10
Background	omega-Agatoxin TK is a peptide toxin originally isolated from Agelenopsis aperta spider venoM omega-Agatoxin TK was shown to be a selective and reversible blocker of CaV2.1 (P/Q type) channels1. Originally the toxin was designated omega-Agatoxin IVB5-8.
Biological Activity	omega-Agatoxin TK is an antagonist of voltage-sensitive P-type Ca2+ channels1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	5273 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P37045
Concentration	20 nM - 1 uM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Cited Application: Electrophysiology Is Toxin: Yes
Cas Number	158484-42-5
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys4-Cys20, Cys12-Cys25, Cys19-Cys36 and Cys27-Cys34 Ser46 - D-amino acid
Origin	Agelenopsis aperta (North American funnel-web spider) (Agelenopsis gertschi)

Synonyms	omega-Agatoxin IVB, Omega-agatoxin IVC , Omega-agatoxin-Aa4b, Omega-AGTX-Aa4b, Omega-agatoxin tsukuba (omega-Aga-TK), Omega-agatoxin-4B
Gene Id	CACNA1A
Sequence	EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA-OH
Target	P-type and Q-type Ca2+ channels

Country Of Origin	Israel/IL
Purity	>=99% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Teramoto, T. et al. (1993) Biochem. Biophys. Res. Commun. 196, 134. Teramoto, T. et al. (1997) Brain Res. 756, 225. Teramoto, T. et al. (1995) Neuroreport 6, 1684. Barral, J. et al. (2001) Eur. J. Pharmacol. 430, 167. Adams, M.E. et al. (1993) Mol. Pharm. 44, 681. Heck, S.D. et al. (1994) Science 266, 1065. Heck, S. D. et al. (1994) J. Amer. Chem. Soc. 116, 10426. Yu, H. et al. (1993) Biochemistry 32, 13123. Teramoto, T. et al. (1993) Biochem. Biophys. Res. Commun. 196, 134.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300135-1	STA-530_0.1 mg	0.1 mg	$262		Add to Cart
BHP21300135-2	STA-530_0.25 mg	0.25 mg	$524		Add to Cart
BHP21300135-3	STA-530_0.5 mg	0.5 mg	$879		Add to Cart
BHP21300135-4	STA-530_1 mg	1 mg	$1406		Add to Cart
BHP21300135-5	STA-530_50 mcg	50 mcg	$185		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.