JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

omega-Agatoxin IVA-ATTO Fluor-647N

SKU : BHP21300134

A Fluorescent Conjugate Marker for Sensitive Detection of P/Q-Type CaV Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STA-500-FRN, STA-500-FRN_10 mcg, STA-500-FRN_5 mcg
Description	A Fluorescent Conjugate Marker for Sensitive Detection of P/Q-Type CaV Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is lyophilized in 0.5 ml conical vial. The product is soluble in pure water to high-micromolar concentrations (5 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity. Avoid exposure to light.
Background	Native omega-Agatoxin IVA (omega-Aga-IVA) was originally isolated from Agelenopsis aperta spider venom, and was shown to be a selective blocker of CaV2.1 (P/Q type) channels1. However, the sensitivity depends on the auxiliary b subunit isoform2 and on the splice variant3. Therefore, the effective concentration varies between systems. In accordance, the toxin blocks presynaptic Ca2+ currents and synaptic transmission in a variety of synapses4,5. omega-Agatoxin IVA is widely used in electrophysiological measurements of cloned and native channels6,7. It is used to assess the role of CaV2.1 channels in synaptic transmission4. In addition, it was used to map the spatial distribution of CaV2.1 channels in mouse cerebellar and hippocampal brain slices8.
Biological Activity	omega-Agatoxin IVA is a blocker of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presynaptically in a variety of synapses2,3.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	~6144 Da
Solubility	The product is lyophilized in 0.5 ml conical vial.Centrifuge the vial before adding solvent (10,000 x g for 5 minutes). The lyophilizate may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. Soluble in pure water at high-micromolar concentrations (50 uM - 1 mM). For long-term storage in solution, it is recommended to prepare a stock solution by dissolving the product in double distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations at 10,000 x g for 5 minutes before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity. Avoid exposure to light
Source	Modified synthetic peptide
Concentration	0.5 3 uM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys4-Cys20, Cys12-Cys25, Cys19-Cys36 and Cys27-Cys34 ATTO Fluor-647N
Origin	Agelenopsis aperta (North American funnel-web spider) (Agelenopsis gertschi)

Synonyms	Omega-agatoxin-Aa4a, omega-AGTX-Aa4a, omega-Aga-IVA, omega-agatoxin-4A
Gene Id	CACNA1A
Sequence	KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA-OH
Target	P-type Ca2+ channels

Country Of Origin	Israel/IL
Storage	Storage After Reconstitution: Store the reconstituted solution at -20°C for the shortest time possible. Avoid multiple freeze-thaw cycles. We do not recommend storing the product in working solutions for longer than a day. Avoid exposure to light. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Avoid exposure to light. Storage of solutions: Store the reconstituted solution at -20°C for the shortest time possible. Avoid multiple freeze-thaw cycles. We do not recommend storing the product in working solutions for longer than a day. Avoid exposure to light.

Applications	Electrophysiology, Live cell imaging, Immunofluorescence, Fluorescence staining, Direct flow cytometry

Reference	Mintz, I.M. et al. (1992) Nature 355, 827. Moreno, H. et al. (1997) Proc. Natl. Acad. Sci. 94, 14042. Bourinet, E. et al. (1999) Nat. Neurosci. 2, 407. Meir, A. et al. (1999) Physiol. Rev. 79, 1019. Stephens, G.J. et al. (2001) Eur. J. Neurosci. 13, 1902. Berrow, N.S. et al. (1997) Eur. J. Neurosci. 9, 739. Pearson, H.A. et al. (1995) J. Physiol. 482, 493. Nakanishi, S. et al. (1995) J. Neurosci. Res. 41, 532. Mintz, I. et al. (1992) Nature 355, 827. Meir, A. et al. (1999) Physiol. Rev. 79, 1019. Stephens, G.J. et al. (2001) Eur. J. Neurosci. 13, 1902.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300134-1	STA-500-FRN_10 mcg	10 mcg	$821		Add to Cart
BHP21300134-2	STA-500-FRN_5 mcg	5 mcg	$543		Add to Cart
BHP21300134-3	STA-500-FRN_10 mcg	2x10 mcg	$1439		Add to Cart
BHP21300134-4	STA-500-FRN_10 mcg	5x10 mcg	$2439		Add to Cart
BHP21300134-5	STA-500-FRN_10 mcg	10x10 mcg	$3345		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.