JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Noxiustoxin

SKU : BHP21300258

A Potent Blocker of KV1.2 and KV1.3 Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STN-340, STN-340_0.1 mg, STN-340_10 mcg, STN-340_5 mcg
Description	A Potent Blocker of KV1.2 and KV1.3 Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C174H286N52O54S7
Background	Noxiustoxin was originally isolated from the venom of the scorpion Centruroides noxius Hoffmann1 and was shown to interact and inhibit KV1.2 and KV1.3 K+ channels.2 The toxin blocks KV1.3 (recorded using patch clamp in Jurkat cells) with Kd of 6 nM3 It was shown to bind synaptosomal membranes4 and to increase transmitter release.5 In addition, it was shown to block K+ channels in lymphocytes.6
Biological Activity	Noxiustoxin inhibits KV1.2 and KV1.3 K+ channels1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	4195 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P08815
Concentration	10 - 200 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
Cas Number	85205-49-8
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys7-Cys29, Cys13-Cys34, and Cys17-Cys36 Asn39 - C-terminal amidation
Origin	Centruroides noxius (Mexican scorpion)

Synonyms	K+ channel toxin alpha-KTx 2.1, NTx, Toxin II.11
Gene Id	KCNA1 ,KCNA2 ,KCNA3,KCNA5,KCNC1,KCNMA1 ,KCNN4
Sequence	TIINVKCTSPKQCSKPCKELYGSSAGAKCMNGKCKCYNN-NH2
Target	KV1.2, KV1.3 K+ channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Possani, L.D. et. al. (1982) Carlsberg Res. Commun. 47, 285. Grissmer, S. et. al. (1994) Mol. Pharmacol. 45, 1227. Mullmann, T.J. et. al. (2001) Biochemistry 40, 10987. Martinez, F. et. al. (1996) Toxicon 34, 1413. Stiges, M. et. al. (1986) J. Neurosci. 6, 1570. Drakopoulou, E. et. al. (1995) Biochem. Biophys. Res. Commun. 213, 901. Grissmer, S. et. al. (1994) Mol. Pharmacol. 45, 1227.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300258-1	STN-340_0.1 mg	0.1 mg	$542		Add to Cart
BHP21300258-2	STN-340_10 mcg	10 mcg	$129		Add to Cart
BHP21300258-3	STN-340_5 mcg	5 mcg	$91		Add to Cart
BHP21300258-4	STN-340_10 mcg	5x10 mcg	$506		Add to Cart
BHP21300258-5	STN-340_5 mcg	5x5 mcg	$355		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.