JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Muscarinic Toxin 7

SKU : BHP21300249

An Antagonist of M1 Muscarinic Receptor

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STM-200, STM-200_0.1 mg, STM-200_0.25 mg, STM-200_0.5 mg, STM-200_1 mg, STM-200_10 mg, STM-200_5 mg
Description	An Antagonist of M1 Muscarinic Receptor
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C322H484N90O98S9
Background	The action of the neurotransmitter acetylcholine (Ach) is mediated through two types of receptors, the ionotropic nicotinic receptors and the metabotropic muscarinic receptors. The muscarinic receptors belong to the superfamily of G-protein coupled receptors. Five subtypes of muscarinic receptors have been cloned: m1-m51,2.The muscarinic receptors are widely distributed throughout the body, but are predominantly expressed within the parasympathetic nervous system and exert both excitatory and inhibitory control over central and peripheral tissues1,2.Muscarinic receptors participate in a number of physiological functions such as regulation of heart rate, muscle contraction, cognition, sensory processing and motor control1. They also participate in learning and memory processing3,4.Muscarinic Toxin 7 is a 65 amino acid peptide toxin isolated from the Dendroaspis angusticeps (Eastern green mamba)5. It was first found to inhibit M1 muscarinic receptors stably transfected in CHO cells at very low concentrations (1-30 nM)6 and acts as a non-competitive antagonist by binding to an allosteric site6.Muscarinic Toxin 7 binding studies using a M1 and M3 chimera demonstrated that the high affinity of Muscarinic Toxin 7 towards M1 receptor is due to only three residues located in the 2nd and 3rd extracellular loops of the receptor7.
Biological Activity	Uncompetitive antagonist of M1 AChR1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	7472.5 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic protein
Accession Number	Q8QGR0
Concentration	1 - 100 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
Cas Number	135541-77-4
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys3-Cys24, Cys17-Cys42, Cys46-Cys57, Cys58-Cys63
Origin	Dendroaspis angusticeps (Eastern green mamba) (Naja angusticeps)

Synonyms	Muscarinic toxin-7, MT7, muscarinic m1-toxin, m1-toxin1
Gene Id	CHRM1
Sequence	LTCVKSNSIWFPTSEDCPDGQNLCFKRWQYISPRMYDFTRGCAATCPKAEYRDVINCCGTDKCNK-OH
Target	M1 muscarinic receptor

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Felder, C.C. et al. (2000) J. Med. Chem. 43, 4333. Forsythe, S.M. et al. (2002) Am. J. Respir. Cell. Mol. Biol. 26, 298. Ferreira, A.R. et al. (2003) Pharmacol. Biochem. Behav. 74, 411. Van der Zee, E.A. et al. (1999) Prog. Neurol. 58, 409. Adem, A. and Karlsson, E. (1997) Life Sci. 60, 1069. Olianas, M.C. et al. (2000) Br. J. Pharmacol. 131, 447. Kukkonen, A. et al. (2004) J. Biol. Chem. 279, 50923. Olianas, M.C. et al. (2000) Br. J. Pharmacol. 131, 447.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300249-1	STM-200_0.1 mg	0.1 mg	$185		Add to Cart
BHP21300249-2	STM-200_0.25 mg	0.25 mg	$384		Add to Cart
BHP21300249-3	STM-200_0.5 mg	0.5 mg	$766		Add to Cart
BHP21300249-4	STM-200_1 mg	1 mg	$1224		Add to Cart
BHP21300249-5	STM-200_10 mg	10 mg	$6852		Add to Cart
BHP21300249-6	STM-200_5 mg	5 mg	$4282		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.