JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Muscarinic Toxin 3

SKU : BHP21300072

An Antagonist of M1 and M4 Muscarinic Receptors and Adrenoceptors

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	M-140, M-140_0.1 mg, M-140_0.25 mg, M-140_0.5 mg, M-140_1 mg, M-140_5 mg
Description	An Antagonist of M1 and M4 Muscarinic Receptors and Adrenoceptors
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C319H489N89O97S8
Background	Muscarinic toxins are isolated from the venom of the mamba species and are composed of 65 to 66 amino acid residues with four intramolecular disulfide bridges. One of these is muscarinic toxin 3 (MT-3) which was isolated from the green mamba (Dendroaspis augusticeps) and is composed of 65 amino acid residues1. A recent study investigated the interaction of MT3 with cloned receptors (mAChRs and adrenoceptors) expressed in insect cells by radioligand binding. MT3 appears to have a broad spectrum of targets showing high-affinity binding (IC50 = 1-10 nM) to M4 mAChR, alpha1A-, alpha1D- and alpha2A-adrenoceptors and lower affinity binding (IC50 > 25 nM) to alpha1B- and alpha2C-adrenoceptors and M1 mAChR2.
Biological Activity	Muscarinic receptor 4 and adrenoceptor antagonist1-4.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	7379 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Natural protein
Accession Number	P81031
Concentration	100 nM - 1 uM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys3-Cys24, Cys17-Cys42, Cys46-Cys57and Cys58-Cys63
Origin	Dendroaspis angusticeps (Eastern green mamba).

Synonyms	MT3, MT-3
Gene Id	ADRA1A,ADRA1B,ADRA1D,ADRA2A,ADRA2C,CHRM1,CHRM4
Sequence	LTCVTKNTIFGITTENCPAGQNLCFKRWHYVIPRYTEITRGCAATCPIPENYDSIHCCKTDKCNE-OH
Target	M1, M4 muscarinic receptors, adrenoceptors

Country Of Origin	Israel/IL
Purity	>99% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Calcium imaging assay

Reference	Bradley, K.N. (2000) Pharmacol. Ther. 85, 87. Nareoja, K. et al. (2011) Br. J. Pharmacol. 164, 538. Jolkkonen, M. et al. (1994) FEBS Lett. 352, 91. Karlsson, E. et al. (1994) Ann. N.Y. Acad. Sci. 710, 153. Caulfield, M.P. and Birdsall, N.J. (1998) Pharm. Rev. 50, 279. Nareoja, K. et al. (2011) Br. J. Pharmacol. 164, 538.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300072-1	M-140_0.1 mg	0.1 mg	$185		Add to Cart
BHP21300072-2	M-140_0.25 mg	0.25 mg	$302		Add to Cart
BHP21300072-3	M-140_0.5 mg	0.5 mg	$483		Add to Cart
BHP21300072-4	M-140_1 mg	1 mg	$769		Add to Cart
BHP21300072-5	M-140_5 mg	5 mg	$3074		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.